Q97U48 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97U48 - Uncharacterized protein

UniProt:	Q97U48	Sequences: MRVSKSKKPTEICPIVSAIAIIGSEPKLLTIRYLLDGPKRFNELQRLTSLSSKTLSKTLKELENHGIVERKIINSHPIVAVYELTDKGKDLKRVFDELRRWGEKFALTKIAVMNSIRVNQEF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	122 (100)
Sequences:	9833 (6082)
Seq/√Len:	608.2

ECOLI - YTFH
BACSU - YDEP YKVN YYBR YTCD HXLR YODB YVAP YDZF
HALSA - Q9HPZ4 Q9HRG9
SULSO - Q97U48 Q97UU6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
45_Q	52_S	2.927	1.00
69_E	83_E	2.814	1.00
90_D	104_K	2.729	1.00
53_K	57_K	2.675	1.00
35_L	92_K	2.594	1.00
71_K	83_E	2.557	1.00
75_S	79_V	2.527	1.00
34_L	68_V	2.339	1.00
69_E	85_T	2.194	1.00
73_I	81_V	1.968	1.00
87_K	105_F	1.832	1.00
34_L	44_L	1.816	1.00
97_E	100_R	1.781	1.00
94_V	97_E	1.748	1.00
73_I	79_V	1.732	1.00
93_R	97_E	1.709	1.00
84_L	88_G	1.669	1.00
30_T	58_T	1.603	1.00
38_P	83_E	1.601	1.00
60_K	63_E	1.598	1.00
38_P	81_V	1.595	1.00
54_T	57_K	1.483	1.00
27_K	61_E	1.446	1.00
89_K	92_K	1.382	1.00
67_I	88_G	1.373	1.00
70_R	80_A	1.364	1.00
86_D	89_K	1.340	1.00
18_A	98_L	1.336	1.00
27_K	58_T	1.316	1.00
90_D	101_W	1.298	1.00
87_K	90_D	1.282	1.00
24_S	61_E	1.231	1.00
21_I	65_H	1.221	1.00
52_S	56_S	1.203	1.00
73_I	77_P	1.171	1.00
99_R	103_E	1.166	1.00
63_E	68_V	1.149	1.00
39_K	43_E	1.142	1.00
42_N	46_R	1.141	1.00
34_L	39_K	1.135	1.00
17_S	106_A	1.124	1.00
24_S	58_T	1.119	1.00
18_A	102_G	1.117	1.00
27_K	62_L	1.102	1.00
87_K	108_T	1.074	1.00
72_I	77_P	1.068	1.00
71_K	81_V	1.059	1.00
31_I	84_L	1.059	1.00
67_I	91_L	1.054	1.00
41_F	56_S	1.051	1.00
56_S	60_K	1.045	1.00
90_D	105_F	1.045	1.00
83_E	89_K	1.027	1.00
74_N	77_P	1.024	1.00
40_R	81_V	1.023	1.00
72_I	80_A	1.020	1.00
73_I	78_I	0.998	1.00
72_I	78_I	0.998	1.00
73_I	76_H	0.982	1.00
28_L	95_F	0.975	1.00
24_S	27_K	0.965	1.00
54_T	58_T	0.961	1.00
92_K	96_D	0.956	1.00
21_I	67_I	0.946	1.00
91_L	101_W	0.938	1.00
35_L	84_L	0.931	1.00
50_L	55_L	0.904	1.00
66_G	87_K	0.892	1.00
30_T	47_L	0.891	1.00
36_D	39_K	0.890	1.00
43_E	46_R	0.883	1.00
100_R	104_K	0.880	1.00
41_F	52_S	0.869	1.00
42_N	45_Q	0.867	1.00
51_S	54_T	0.860	1.00
16_V	20_A	0.858	1.00
93_R	100_R	0.851	1.00
32_R	99_R	0.836	1.00
27_K	65_H	0.822	1.00
61_E	65_H	0.812	1.00
39_K	44_L	0.800	1.00
35_L	96_D	0.800	1.00
33_Y	44_L	0.798	1.00
30_T	50_L	0.795	1.00
96_D	100_R	0.793	1.00
33_Y	47_L	0.759	1.00
72_I	76_H	0.757	1.00
94_V	98_L	0.753	1.00
76_H	80_A	0.730	1.00
26_P	50_L	0.726	1.00
72_I	75_S	0.719	1.00
32_R	35_L	0.717	1.00
14_P	103_E	0.710	1.00
11_E	16_V	0.693	1.00
57_K	61_E	0.689	1.00
11_E	20_A	0.679	1.00
40_R	73_I	0.678	1.00
102_G	106_A	0.670	1.00
33_Y	36_D	0.668	1.00
91_L	94_V	0.663	1.00
29_L	33_Y	0.660	1.00
17_S	105_F	0.656	1.00
96_D	99_R	0.654	1.00
19_I	98_L	0.652	1.00
33_Y	39_K	0.632	1.00
103_E	106_A	0.631	1.00
105_F	108_T	0.619	1.00
34_L	38_P	0.615	1.00
42_N	52_S	0.612	1.00
45_Q	55_L	0.609	1.00
17_S	109_K	0.607	1.00
15_I	106_A	0.605	1.00
31_I	91_L	0.604	1.00
40_R	43_E	0.601	1.00
19_I	28_L	0.600	1.00
50_L	80_A	0.598	1.00
75_S	78_I	0.598	1.00
63_E	72_I	0.581	1.00
86_D	90_D	0.581	1.00
100_R	103_E	0.575	1.00
19_I	91_L	0.574	1.00
75_S	81_V	0.573	1.00
93_R	96_D	0.569	1.00
90_D	93_R	0.569	1.00
17_S	20_A	0.567	1.00
62_L	67_I	0.566	1.00
38_P	44_L	0.563	1.00
52_S	58_T	0.560	1.00
15_I	32_R	0.558	1.00
34_L	84_L	0.552	0.99
34_L	63_E	0.552	0.99
63_E	70_R	0.551	0.99
77_P	80_A	0.548	0.99
87_K	109_K	0.546	0.99
41_F	45_Q	0.540	0.99
101_W	105_F	0.537	0.99
105_F	109_K	0.534	0.99
38_P	47_L	0.532	0.99
11_E	17_S	0.530	0.99
83_E	86_D	0.524	0.99
94_V	102_G	0.517	0.99
93_R	104_K	0.516	0.99
38_P	71_K	0.515	0.99
16_V	28_L	0.515	0.99
44_L	47_L	0.514	0.99
87_K	106_A	0.514	0.99
37_G	89_K	0.508	0.99
104_K	107_L	0.502	0.99
99_R	102_G	0.501	0.99
13_C	41_F	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4gcvA	3	0.9016	99.9	0.418	Contact Map
4a5nA	2	0.8525	99.7	0.511	Contact Map
1yyvA	2	0.8934	99.7	0.513	Contact Map
2hztA	2	0.7705	99.7	0.521	Contact Map
1z7uA	2	0.9016	99.7	0.523	Contact Map
2fswA	2	0.8361	99.6	0.539	Contact Map
2f2eA	4	0.9508	99.6	0.541	Contact Map
4hw0A	2	0.8033	99.6	0.558	Contact Map
3df8A	2	0.8279	99.5	0.586	Contact Map
4hqeA	2	0.8607	99.3	0.618	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.