Q97U40 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97U40 - Uncharacterized protein

UniProt:	Q97U40	Sequences: MKVVIGYDGSDHAKKALFFTLNLIKKEDEIHLVTIVKEAPRSPEQVIIQSEQRAKQMQDEVVNELGDYKIVQKILESNEVADSILQYCNNIGCGLIVTGSRGLTGIKKAILGSVSSALVSKSNVPVLVVK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	130 (125)
Sequences:	19074 (15639)
Seq/√Len:	1398.8

ECOLI - USPE USPG USPF USPC USPD USPA
BACSU - NHAX YXIE
HALSA - Q9HHV8 Q9HRD8 Q9HNX9 Q9HPP5 Q9HRP5 Q9HHX5 Q9HPQ8 Q9HPF7 Q9HMI9 Q9HMJ0 Q9HP90 Q9HHY0 Q9HMU1
SULSO - Q97U40 Q97V57 Q97X90 Q7LXW4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
4_V	93_C	3.012	1.00
81_A	117_A	2.850	1.00
19_F	127_L	2.838	1.00
95_L	127_L	2.527	1.00
98_T	118_L	2.103	1.00
31_H	74_I	2.088	1.00
96_I	124_V	2.051	1.00
31_H	93_C	2.022	1.00
29_E	71_V	1.998	1.00
116_S	120_S	1.986	1.00
78_N	83_S	1.942	1.00
31_H	87_Y	1.942	1.00
18_F	64_E	1.891	1.00
6_G	98_T	1.875	1.00
5_I	20_T	1.867	1.00
88_C	96_I	1.858	1.00
31_H	73_K	1.856	1.00
35_I	83_S	1.838	1.00
33_V	87_Y	1.811	1.00
76_E	83_S	1.651	1.00
83_S	86_Q	1.611	1.00
6_G	84_I	1.599	1.00
23_L	27_E	1.588	1.00
20_T	24_I	1.571	1.00
62_V	66_G	1.511	1.00
96_I	122_S	1.497	1.00
5_I	17_L	1.491	1.00
34_T	54_A	1.455	1.00
85_L	121_K	1.454	1.00
89_N	123_N	1.449	1.00
117_A	121_K	1.446	1.00
55_K	59_D	1.414	1.00
14_K	64_E	1.409	1.00
54_A	58_Q	1.399	1.00
74_I	87_Y	1.391	1.00
88_C	123_N	1.370	1.00
29_E	73_K	1.367	1.00
51_E	55_K	1.364	1.00
96_I	118_L	1.275	1.00
47_I	51_E	1.273	1.00
122_S	126_V	1.250	1.00
57_M	61_V	1.228	1.00
76_E	87_Y	1.205	1.00
35_I	80_V	1.201	1.00
87_Y	93_C	1.182	1.00
100_S	128_V	1.181	1.00
80_V	114_V	1.177	1.00
108_K	116_S	1.155	1.00
14_K	60_E	1.125	1.00
106_I	110_I	1.124	1.00
88_C	124_V	1.116	1.00
57_M	60_E	1.108	1.00
19_F	23_L	1.105	1.00
50_S	53_R	1.098	1.00
33_V	84_I	1.093	1.00
9_G	34_T	1.079	1.00
59_D	62_V	1.067	1.00
53_R	57_M	1.028	1.00
52_Q	56_Q	1.026	1.00
27_E	94_G	1.023	1.00
61_V	65_L	1.023	1.00
98_T	115_S	1.023	1.00
25_K	68_Y	1.001	1.00
85_L	88_C	1.000	1.00
7_Y	32_L	0.995	1.00
119_V	128_V	0.992	1.00
54_A	57_M	0.991	1.00
33_V	76_E	0.972	1.00
17_L	32_L	0.962	1.00
21_L	68_Y	0.961	1.00
62_V	72_Q	0.957	1.00
13_A	16_A	0.949	1.00
17_L	61_V	0.942	1.00
3_V	95_L	0.931	1.00
88_C	93_C	0.929	1.00
59_D	63_N	0.929	1.00
20_T	97_V	0.926	1.00
24_I	30_I	0.916	1.00
22_N	26_K	0.909	1.00
100_S	115_S	0.874	1.00
85_L	118_L	0.872	1.00
49_Q	53_R	0.872	1.00
103_L	107_K	0.864	1.00
115_S	128_V	0.862	1.00
10_S	13_A	0.857	1.00
105_G	108_K	0.857	1.00
14_K	18_F	0.849	1.00
36_V	77_S	0.848	1.00
7_Y	16_A	0.846	1.00
17_L	21_L	0.844	1.00
53_R	56_Q	0.844	1.00
32_L	65_L	0.844	1.00
19_F	22_N	0.843	1.00
48_I	52_Q	0.841	1.00
79_E	82_D	0.837	1.00
60_E	63_N	0.831	1.00
19_F	129_V	0.828	1.00
21_L	65_L	0.824	1.00
20_T	30_I	0.822	1.00
85_L	122_S	0.820	1.00
24_I	27_E	0.818	1.00
83_S	87_Y	0.815	1.00
50_S	54_A	0.815	1.00
4_V	87_Y	0.809	1.00
4_V	96_I	0.808	1.00
61_V	64_E	0.808	1.00
44_E	48_I	0.807	1.00
15_K	18_F	0.806	1.00
66_G	69_K	0.804	1.00
10_S	102_G	0.803	1.00
73_K	87_Y	0.803	1.00
52_Q	55_K	0.796	1.00
19_F	125_P	0.795	1.00
49_Q	52_Q	0.782	1.00
92_G	124_V	0.776	1.00
4_V	33_V	0.770	1.00
7_Y	61_V	0.768	1.00
7_Y	17_L	0.763	1.00
60_E	64_E	0.759	1.00
97_V	127_L	0.758	1.00
106_I	109_A	0.755	1.00
65_L	68_Y	0.748	1.00
111_L	115_S	0.742	1.00
21_L	25_K	0.740	1.00
45_Q	48_I	0.735	1.00
7_Y	14_K	0.733	1.00
5_I	30_I	0.724	1.00
105_G	109_A	0.717	1.00
102_G	111_L	0.716	1.00
84_I	118_L	0.716	1.00
6_G	99_G	0.704	1.00
81_A	114_V	0.703	1.00
64_E	68_Y	0.698	1.00
98_T	128_V	0.693	1.00
63_N	66_G	0.682	1.00
44_E	47_I	0.678	1.00
77_S	83_S	0.673	1.00
23_L	127_L	0.672	1.00
64_E	67_D	0.668	1.00
23_L	26_K	0.667	1.00
81_A	85_L	0.662	1.00
32_L	72_Q	0.660	1.00
100_S	110_I	0.657	1.00
69_K	72_Q	0.652	1.00
32_L	61_V	0.651	1.00
45_Q	49_Q	0.643	1.00
46_V	49_Q	0.642	1.00
46_V	50_S	0.630	1.00
7_Y	13_A	0.629	1.00
21_L	64_E	0.616	1.00
3_V	97_V	0.615	1.00
89_N	124_V	0.613	1.00
97_V	129_V	0.613	1.00
36_V	54_A	0.613	1.00
8_D	13_A	0.612	1.00
56_Q	59_D	0.610	1.00
35_I	78_N	0.607	1.00
12_H	15_K	0.605	1.00
34_T	57_M	0.603	1.00
63_N	67_D	0.602	1.00
118_L	126_V	0.602	1.00
101_R	115_S	0.602	1.00
81_A	118_L	0.601	1.00
29_E	94_G	0.601	1.00
11_D	14_K	0.601	1.00
29_E	69_K	0.598	1.00
119_V	126_V	0.595	1.00
3_V	24_I	0.593	1.00
54_A	75_L	0.581	1.00
5_I	16_A	0.579	1.00
56_Q	60_E	0.579	1.00
33_V	83_S	0.575	1.00
9_G	61_V	0.573	1.00
99_G	129_V	0.570	1.00
14_K	61_V	0.568	1.00
22_N	25_K	0.568	1.00
25_K	28_D	0.566	1.00
9_G	57_M	0.566	1.00
82_D	86_Q	0.562	1.00
51_E	54_A	0.560	1.00
23_L	97_V	0.546	1.00
48_I	51_E	0.543	1.00
85_L	117_A	0.540	1.00
47_I	77_S	0.524	1.00
31_H	71_V	0.518	1.00
58_Q	62_V	0.513	1.00
111_L	119_V	0.512	1.00
14_K	57_M	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2gm3A	2	0.8923	99.9	0.19	Contact Map
2dumA	2	0.9923	99.8	0.204	Contact Map
3s3tA	4	1	99.8	0.205	Contact Map
5ahwA	4	1	99.8	0.206	Contact Map
4wnyA	2	0.8846	99.8	0.208	Contact Map
1mjhA	2	0.9923	99.8	0.209	Contact Map
3hgmA	2	0.9923	99.8	0.211	Contact Map
3dloA	2	0.9692	99.8	0.221	Contact Map
3loqA	1	0.9846	99.8	0.23	Contact Map
1tq8A	4	0.9	99.8	0.236	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.