Q97U25 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97U25 - Uncharacterized protein

UniProt:	Q97U25	Sequences: MKSYILLIKCKTDTTIRTKSKKFLIRKGVYAYVGSCGRSCGRRVSRHFNKEKSNYHWHIDYLTKACEPIGVFVMNHVGEKELALLFSKNNAFIEEFGSSDDKDAKSHLFIVNDLQELCSTVCDKSRER	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	128 (110)
Sequences:	318 (284)
Seq/√Len:	27.1

HALSA - Q9HRH5
SULSO - Q97U25

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
101_D	104_A	4.414	1.00
80_K	101_D	4.379	1.00
80_K	104_A	4.320	1.00
5_I	31_A	3.898	1.00
8_I	63_T	3.780	1.00
83_A	109_F	3.689	1.00
5_I	33_V	2.358	0.99
18_T	21_K	2.251	0.98
21_K	25_I	2.208	0.98
6_L	59_I	2.038	0.96
49_N	52_K	2.013	0.96
96_F	108_L	1.936	0.95
33_V	109_F	1.874	0.94
104_A	107_H	1.871	0.94
55_Y	64_K	1.851	0.94
59_I	63_T	1.829	0.93
101_D	107_H	1.772	0.92
13_D	27_K	1.698	0.91
62_L	108_L	1.607	0.88
19_K	25_I	1.574	0.87
10_C	30_Y	1.572	0.87
80_K	107_H	1.553	0.86
20_S	50_K	1.550	0.86
6_L	63_T	1.533	0.85
18_T	25_I	1.521	0.85
10_C	25_I	1.503	0.84
19_K	61_Y	1.467	0.83
45_S	49_N	1.452	0.82
37_G	77_V	1.449	0.82
86_F	109_F	1.329	0.76
10_C	14_T	1.285	0.73
11_K	14_T	1.232	0.70
18_T	23_F	1.183	0.67
23_F	93_I	1.175	0.66
13_D	24_L	1.172	0.66
17_R	20_S	1.123	0.63
52_K	63_T	1.118	0.62
3_S	37_G	1.112	0.62
82_L	90_N	1.109	0.62
96_F	106_S	1.096	0.61
19_K	99_S	1.060	0.58
90_N	111_V	1.040	0.57
94_E	98_S	1.033	0.56
88_K	92_F	1.017	0.55
72_F	99_S	1.008	0.54
7_L	14_T	1.003	0.54
7_L	29_V	0.993	0.53
92_F	98_S	0.992	0.53
26_R	92_F	0.986	0.53
12_T	82_L	0.972	0.52
3_S	82_L	0.971	0.52
46_R	80_K	0.964	0.51
33_V	37_G	0.963	0.51
62_L	95_E	0.948	0.50
15_T	22_K	0.940	0.49
29_V	111_V	0.939	0.49
33_V	83_A	0.936	0.49
19_K	104_A	0.933	0.49
12_T	84_L	0.926	0.48
9_K	29_V	0.906	0.47
8_I	59_I	0.905	0.47
48_F	63_T	0.896	0.46
11_K	85_L	0.883	0.45
6_L	36_C	0.875	0.44
83_A	107_H	0.862	0.43
10_C	68_P	0.858	0.43
74_M	82_L	0.853	0.43
48_F	90_N	0.842	0.42
38_R	42_R	0.828	0.41
33_V	86_F	0.826	0.41
44_V	112_N	0.823	0.41
20_S	41_G	0.822	0.40
38_R	56_H	0.816	0.40
12_T	105_K	0.798	0.39
86_F	92_F	0.797	0.39
44_V	95_E	0.795	0.38
18_T	61_Y	0.789	0.38
33_V	63_T	0.786	0.38
45_S	65_A	0.780	0.37
36_C	40_C	0.768	0.37
56_H	85_L	0.768	0.37
27_K	84_L	0.760	0.36
21_K	61_Y	0.759	0.36
31_A	111_V	0.759	0.36
19_K	107_H	0.753	0.36
38_R	41_G	0.753	0.36
51_E	67_E	0.748	0.35
9_K	69_I	0.742	0.35
16_I	72_F	0.729	0.34
39_S	77_V	0.723	0.33
39_S	111_V	0.720	0.33
8_I	68_P	0.705	0.32
70_G	110_I	0.700	0.32
10_C	65_A	0.695	0.32
8_I	16_I	0.687	0.31
91_A	98_S	0.686	0.31
25_I	61_Y	0.682	0.31
12_T	24_L	0.676	0.30
36_C	101_D	0.674	0.30
30_Y	55_Y	0.673	0.30
65_A	70_G	0.669	0.30
69_I	84_L	0.662	0.30
29_V	110_I	0.660	0.29
92_F	106_S	0.658	0.29
9_K	67_E	0.655	0.29
7_L	16_I	0.642	0.28
14_T	65_A	0.639	0.28
40_C	52_K	0.638	0.28
5_I	86_F	0.635	0.28
41_G	111_V	0.628	0.27
78_G	82_L	0.626	0.27
40_C	49_N	0.626	0.27
25_I	80_K	0.615	0.27
40_C	111_V	0.615	0.27
87_S	106_S	0.608	0.26
8_I	67_E	0.605	0.26
62_L	83_A	0.601	0.26
66_C	73_V	0.598	0.26
19_K	101_D	0.587	0.25
67_E	74_M	0.587	0.25
26_R	110_I	0.585	0.25
68_P	71_V	0.584	0.25
76_H	88_K	0.584	0.25
67_E	93_I	0.583	0.25
9_K	94_E	0.581	0.25
50_K	56_H	0.581	0.25
85_L	88_K	0.576	0.24
74_M	84_L	0.574	0.24
33_V	84_L	0.568	0.24
12_T	112_N	0.559	0.23
74_M	86_F	0.558	0.23
36_C	104_A	0.557	0.23
46_R	82_L	0.557	0.23
45_S	75_N	0.555	0.23
83_A	93_I	0.552	0.23
11_K	67_E	0.549	0.23
88_K	106_S	0.546	0.23
25_I	107_H	0.540	0.22
59_I	83_A	0.539	0.22
11_K	81_E	0.538	0.22
3_S	13_D	0.535	0.22
41_G	44_V	0.526	0.22
50_K	54_N	0.524	0.22
68_P	82_L	0.523	0.22
109_F	113_D	0.523	0.22
30_Y	98_S	0.523	0.22
66_C	70_G	0.522	0.22
75_N	86_F	0.517	0.21
25_I	76_H	0.516	0.21
21_K	104_A	0.515	0.21
25_I	104_A	0.515	0.21
17_R	103_D	0.514	0.21
88_K	105_K	0.511	0.21
32_Y	58_H	0.500	0.20
58_H	97_G	0.500	0.20
32_Y	79_E	0.500	0.20
32_Y	60_D	0.500	0.20
58_H	79_E	0.500	0.20
32_Y	43_R	0.500	0.20
43_R	58_H	0.500	0.20
43_R	60_D	0.500	0.20
79_E	100_D	0.500	0.20
43_R	79_E	0.500	0.20
43_R	97_G	0.500	0.20
43_R	100_D	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1mk0A	1	0.6328	65.2	0.919	Contact Map
1yd6A	5	0.6797	58.5	0.922	Contact Map
1yd0A	1	0.6406	57.6	0.923	Contact Map
2wshA	4	0.7188	20.2	0.94	Contact Map
3clwA	1	0.375	18.4	0.941	Contact Map
2c1wA	1	0.3438	13.7	0.945	Contact Map
2wnwA	2	0.4609	13.6	0.945	Contact Map
3og6A	1	0.2812	12.1	0.946	Contact Map
4ccdA	1	0.375	10	0.948	Contact Map
2b3yA	1	0.9297	7.5	0.951	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.