Y3206 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Y3206 - RutC family protein SSO3206

UniProt:	Q97U19	Sequences: MKEIIFTEKAPKPIGPYSQGVKVGDILYVSGQIPVDPKTNEVVGKNIEEQTIRVIENIKAVLEAAGYMLDDVVMSFVYLKDIKDFQRFNEVYSKYFSNKPPARVTVEVSRLPRDVLIEITVIAQKS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	126 (116)
Sequences:	6011 (3829)
Seq/√Len:	355.6

ECOLI - TDCF RIDA RUTC YJGH YOAB
BACSU - RIDA
HALSA - Q9HNH7
SULSO - Y3206

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
52_I	94_K	3.308	1.00
59_K	69_L	2.911	1.00
67_Y	71_D	2.908	1.00
46_N	49_E	2.614	1.00
48_E	87_R	2.506	1.00
74_M	120_T	2.390	1.00
77_V	88_F	2.175	1.00
78_Y	106_V	2.151	1.00
52_I	56_E	2.099	1.00
48_E	90_E	2.047	1.00
56_E	95_Y	2.019	1.00
107_E	110_R	1.962	1.00
110_R	114_D	1.901	1.00
33_I	115_V	1.872	1.00
50_Q	116_L	1.839	1.00
58_I	121_V	1.798	1.00
62_L	123_A	1.786	1.00
59_K	63_E	1.725	1.00
42_V	115_V	1.654	1.00
84_D	116_L	1.601	1.00
75_S	121_V	1.597	1.00
23_V	73_V	1.574	1.00
27_L	67_Y	1.551	1.00
52_I	95_Y	1.550	1.00
79_L	88_F	1.537	1.00
53_R	57_N	1.522	1.00
47_I	51_T	1.502	1.00
56_E	59_K	1.485	1.00
68_M	71_D	1.452	1.00
82_I	107_E	1.426	1.00
36_D	39_T	1.399	1.00
53_R	56_E	1.364	1.00
34_P	115_V	1.350	1.00
104_V	120_T	1.346	1.00
79_L	105_T	1.343	1.00
41_E	113_R	1.292	1.00
22_K	25_D	1.289	1.00
28_Y	122_I	1.269	1.00
23_V	124_Q	1.260	1.00
89_N	103_R	1.254	1.00
80_K	84_D	1.236	1.00
87_R	90_E	1.235	1.00
29_V	61_V	1.224	1.00
31_G	118_E	1.205	1.00
91_V	94_K	1.160	1.00
36_D	43_V	1.158	1.00
92_Y	103_R	1.153	1.00
10_A	19_Q	1.152	1.00
72_V	121_V	1.119	1.00
97_S	100_P	1.109	1.00
9_K	63_E	1.081	1.00
47_I	88_F	1.081	1.00
52_I	91_V	1.081	1.00
62_L	67_Y	1.079	1.00
22_K	27_L	1.079	1.00
29_V	121_V	1.066	1.00
84_D	87_R	1.057	1.00
90_E	93_S	1.055	1.00
26_I	124_Q	1.037	1.00
78_Y	108_V	1.037	1.00
62_L	72_V	1.033	1.00
78_Y	104_V	1.030	1.00
27_L	65_A	1.030	1.00
34_P	54_V	1.026	1.00
22_K	67_Y	1.026	1.00
26_I	73_V	1.012	1.00
80_K	110_R	1.001	1.00
51_T	88_F	0.995	1.00
44_G	49_E	0.984	1.00
80_K	114_D	0.967	1.00
63_E	68_M	0.957	1.00
83_K	110_R	0.943	1.00
76_F	120_T	0.940	1.00
81_D	84_D	0.902	1.00
72_V	96_F	0.878	1.00
80_K	116_L	0.877	1.00
32_Q	61_V	0.869	1.00
75_S	92_Y	0.861	1.00
85_F	105_T	0.858	1.00
48_E	91_V	0.857	1.00
60_A	63_E	0.857	1.00
55_I	95_Y	0.844	1.00
47_I	84_D	0.844	1.00
34_P	50_Q	0.843	1.00
90_E	94_K	0.842	1.00
69_L	72_V	0.839	1.00
20_G	61_V	0.832	1.00
80_K	108_V	0.829	1.00
41_E	44_G	0.825	1.00
59_K	95_Y	0.807	1.00
55_I	119_I	0.807	1.00
70_D	97_S	0.804	1.00
91_V	95_Y	0.789	1.00
37_P	53_R	0.785	1.00
46_N	116_L	0.776	1.00
75_S	96_F	0.775	1.00
25_D	124_Q	0.770	1.00
29_V	104_V	0.762	1.00
35_V	40_N	0.753	1.00
67_Y	124_Q	0.744	1.00
48_E	52_I	0.726	0.99
45_K	49_E	0.726	0.99
16_P	89_N	0.724	0.99
93_S	100_P	0.713	0.99
55_I	69_L	0.711	0.99
14_I	113_R	0.710	0.99
36_D	40_N	0.706	0.99
47_I	117_I	0.705	0.99
20_G	27_L	0.705	0.99
45_K	50_Q	0.704	0.99
47_I	91_V	0.703	0.99
86_Q	90_E	0.703	0.99
89_N	92_Y	0.702	0.99
69_L	95_Y	0.689	0.99
79_L	82_I	0.686	0.99
19_Q	61_V	0.682	0.99
72_V	123_A	0.682	0.99
29_V	58_I	0.681	0.99
82_I	110_R	0.670	0.99
43_V	53_R	0.668	0.99
54_V	119_I	0.663	0.99
80_K	109_S	0.659	0.99
9_K	60_A	0.657	0.99
78_Y	120_T	0.657	0.99
51_T	117_I	0.656	0.99
55_I	92_Y	0.645	0.99
27_L	123_A	0.643	0.99
56_E	60_A	0.642	0.99
74_M	104_V	0.638	0.99
77_V	119_I	0.638	0.99
39_T	43_V	0.630	0.99
21_V	73_V	0.630	0.99
24_G	124_Q	0.630	0.99
81_D	116_L	0.624	0.98
20_G	65_A	0.622	0.98
36_D	41_E	0.615	0.98
76_F	104_V	0.605	0.98
19_Q	64_A	0.599	0.98
49_E	52_I	0.598	0.98
79_L	84_D	0.578	0.98
48_E	94_K	0.575	0.97
23_V	28_Y	0.574	0.97
17_Y	31_G	0.572	0.97
62_L	69_L	0.570	0.97
70_D	98_N	0.569	0.97
33_I	113_R	0.568	0.97
43_V	49_E	0.562	0.97
46_N	87_R	0.560	0.97
18_S	21_V	0.559	0.97
89_N	93_S	0.556	0.97
37_P	60_A	0.555	0.97
44_G	50_Q	0.553	0.97
21_V	102_A	0.551	0.97
23_V	26_I	0.550	0.97
62_L	121_V	0.548	0.97
9_K	38_K	0.534	0.96
34_P	42_V	0.533	0.96
55_I	77_V	0.525	0.96
77_V	117_I	0.523	0.96
74_M	102_A	0.522	0.95
10_A	20_G	0.520	0.95
61_V	64_A	0.516	0.95
33_I	54_V	0.513	0.95
19_Q	60_A	0.513	0.95
30_S	102_A	0.511	0.95
54_V	117_I	0.511	0.95
44_G	116_L	0.507	0.95
77_V	103_R	0.507	0.95
76_F	106_V	0.506	0.95
46_N	50_Q	0.505	0.95
53_R	60_A	0.504	0.95
43_V	46_N	0.501	0.94
67_Y	123_A	0.500	0.94
32_Q	58_I	0.500	0.94

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2b33A	3	0.9921	100	0.132	Contact Map
1xrgA	3	0.9921	100	0.142	Contact Map
2dyyA	3	1	100	0.15	Contact Map
3vczA	5	0.9762	100	0.16	Contact Map
3l7qA	3	0.9841	100	0.16	Contact Map
1qahA	3	1	100	0.161	Contact Map
3r0pA	5	0.9921	100	0.161	Contact Map
2cvlA	3	0.9841	100	0.167	Contact Map
3m1xA	3	0.9841	100	0.167	Contact Map
1x25A	3	1	100	0.168	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.