Q97U00 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97U00 - Uncharacterized protein

UniProt:	Q97U00	Sequences: MSFLYHIIGKSIYSLNLYYLFSYTMINMKEEFVKEYMKTRVITVGRNTMLKEVTRIMTDNNVGSVIVVDNGKPIGIITERDVVRAIGKGKSLDTIAEEIMTASLITIKEDSPITGALSLMRTYNIRHLPVIDYDGNLRGIISIRDIARAIDDILEG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	156 (122)
Sequences:	10328 (7755)
Seq/√Len:	702.1

ECOLI - IMDH GUTQ KDSD
BACSU - CCPN ACUB YHCV YLBB YKUL YTOI IMDH MGTE
HALSA - Q9HQD0 Q9HRK9 Q9HPF4 Q9HMW8 Q9HNT8 Q9HNB6 Q9HR38 IMDH Q9HPN8
SULSO - Q97U00 Q97U20 Q97V95 Q97U50 Q97VN1 Q97VD7 Q981B7 Q7LXN6 Q7LXY4 Q97Z58 Q97U23

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
48_T	52_E	2.963	1.00
64_S	127_H	2.653	1.00
107_I	130_V	2.549	1.00
109_E	132_D	2.286	1.00
107_I	111_S	2.175	1.00
53_V	96_A	2.161	1.00
46_R	97_E	2.158	1.00
105_I	123_Y	2.135	1.00
108_K	111_S	2.090	1.00
111_S	115_G	2.059	1.00
44_V	48_T	1.929	1.00
109_E	138_R	1.884	1.00
45_G	48_T	1.881	1.00
33_V	116_A	1.875	1.00
44_V	65_V	1.869	1.00
46_R	74_I	1.852	1.00
66_I	73_P	1.822	1.00
44_V	67_V	1.807	1.00
44_V	53_V	1.766	1.00
108_K	133_Y	1.758	1.00
94_T	98_E	1.702	1.00
129_P	137_L	1.658	1.00
107_I	116_A	1.640	1.00
105_I	125_I	1.623	1.00
53_V	77_I	1.596	1.00
95_I	98_E	1.573	1.00
34_K	109_E	1.552	1.00
126_R	143_I	1.526	1.00
44_V	96_A	1.501	1.00
42_I	60_N	1.460	1.00
46_R	69_D	1.452	1.00
69_D	72_K	1.452	1.00
56_I	60_N	1.449	1.00
55_R	59_D	1.438	1.00
79_E	83_V	1.382	1.00
69_D	74_I	1.374	1.00
116_A	128_L	1.358	1.00
47_N	97_E	1.351	1.00
48_T	56_I	1.300	1.00
43_T	68_V	1.298	1.00
107_I	128_L	1.277	1.00
34_K	110_D	1.269	1.00
132_D	136_N	1.266	1.00
119_L	123_Y	1.254	1.00
106_T	131_I	1.226	1.00
112_P	115_G	1.169	1.00
73_P	137_L	1.165	1.00
49_M	52_E	1.163	1.00
79_E	126_R	1.154	1.00
50_L	99_I	1.154	1.00
111_S	119_L	1.148	1.00
53_V	65_V	1.128	1.00
32_F	35_E	1.128	1.00
63_G	79_E	1.121	1.00
77_I	96_A	1.118	1.00
77_I	99_I	1.113	1.00
67_V	100_M	1.111	1.00
77_I	82_V	1.106	1.00
36_Y	113_I	1.098	1.00
81_D	101_T	1.093	1.00
36_Y	141_I	1.070	1.00
94_T	99_I	1.057	1.00
52_E	55_R	1.056	1.00
51_K	55_R	1.054	1.00
73_P	104_L	1.036	1.00
105_I	119_L	1.027	1.00
42_I	56_I	1.025	1.00
62_V	65_V	1.022	1.00
31_E	35_E	1.013	1.00
64_S	126_R	0.989	1.00
66_I	137_L	0.982	1.00
76_I	129_P	0.980	1.00
113_I	146_I	0.963	1.00
75_G	100_M	0.954	1.00
118_S	122_T	0.953	1.00
73_P	129_P	0.952	1.00
116_A	141_I	0.947	1.00
38_K	145_D	0.930	1.00
54_T	82_V	0.927	1.00
66_I	129_P	0.905	1.00
119_L	128_L	0.902	1.00
45_G	69_D	0.901	1.00
57_M	65_V	0.888	1.00
71_G	136_N	0.887	1.00
83_V	126_R	0.882	1.00
110_D	133_Y	0.878	1.00
107_I	119_L	0.860	1.00
72_K	136_N	0.848	1.00
51_K	93_D	0.846	1.00
56_I	59_D	0.826	1.00
42_I	62_V	0.821	1.00
33_V	107_I	0.815	1.00
74_I	100_M	0.808	1.00
115_G	119_L	0.800	1.00
121_R	148_R	0.791	1.00
82_V	85_A	0.786	1.00
63_G	126_R	0.784	1.00
44_V	56_I	0.784	1.00
37_M	130_V	0.783	1.00
45_G	68_V	0.783	1.00
96_A	100_M	0.773	1.00
84_R	87_G	0.773	1.00
127_H	142_S	0.770	1.00
64_S	140_I	0.769	1.00
127_H	140_I	0.766	1.00
68_V	74_I	0.760	1.00
63_G	127_H	0.755	1.00
43_T	71_G	0.754	1.00
63_G	66_I	0.752	1.00
91_S	94_T	0.745	1.00
72_K	135_G	0.735	1.00
32_F	110_D	0.734	1.00
64_S	76_I	0.732	1.00
126_R	144_R	0.729	1.00
68_V	73_P	0.728	1.00
129_P	140_I	0.720	1.00
106_T	135_G	0.714	1.00
52_E	56_I	0.714	1.00
120_M	128_L	0.707	1.00
56_I	65_V	0.704	1.00
62_V	66_I	0.700	1.00
144_R	148_R	0.698	1.00
47_N	95_I	0.698	1.00
32_F	112_P	0.696	1.00
131_I	135_G	0.693	1.00
38_K	41_V	0.681	1.00
36_Y	149_A	0.680	1.00
76_I	101_T	0.671	1.00
132_D	138_R	0.670	1.00
63_G	80_R	0.663	1.00
76_I	127_H	0.660	1.00
53_V	57_M	0.645	1.00
115_G	118_S	0.644	1.00
79_E	144_R	0.644	1.00
97_E	102_A	0.640	1.00
108_K	132_D	0.638	1.00
33_V	37_M	0.637	1.00
41_V	66_I	0.635	1.00
135_G	138_R	0.625	1.00
37_M	139_G	0.618	1.00
109_E	133_Y	0.613	1.00
58_T	88_K	0.611	1.00
64_S	78_T	0.608	1.00
143_I	147_A	0.606	1.00
54_T	79_E	0.605	1.00
31_E	149_A	0.605	1.00
76_I	104_L	0.603	1.00
131_I	137_L	0.600	1.00
127_H	143_I	0.600	1.00
63_G	143_I	0.599	1.00
50_L	85_A	0.598	1.00
42_I	65_V	0.582	1.00
40_R	60_N	0.582	1.00
50_L	94_T	0.571	1.00
83_V	87_G	0.560	1.00
117_L	146_I	0.559	1.00
48_T	65_V	0.555	1.00
114_T	118_S	0.555	1.00
33_V	36_Y	0.552	1.00
41_V	62_V	0.547	1.00
85_A	88_K	0.544	1.00
145_D	148_R	0.544	1.00
43_T	65_V	0.543	1.00
108_K	135_G	0.542	1.00
101_T	104_L	0.541	1.00
97_E	100_M	0.540	1.00
85_A	89_G	0.537	1.00
49_M	95_I	0.534	1.00
66_I	74_I	0.534	1.00
80_R	126_R	0.533	1.00
104_L	129_P	0.532	1.00
68_V	71_G	0.530	1.00
37_M	138_R	0.525	1.00
129_P	138_R	0.524	1.00
50_L	53_V	0.523	1.00
51_K	92_L	0.520	1.00
62_V	142_S	0.513	0.99
119_L	122_T	0.510	0.99
90_K	93_D	0.510	0.99
73_P	131_I	0.509	0.99
72_K	134_D	0.502	0.99
58_T	148_R	0.500	0.99
66_I	127_H	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3l2bA	2	0.75	99.9	0.323	Contact Map
4cooA	2	0.9679	99.9	0.343	Contact Map
2ef7A	3	0.8141	99.9	0.348	Contact Map
4esyA	2	0.891	99.8	0.355	Contact Map
3pc3A	2	0.9872	99.8	0.356	Contact Map
2ouxA	2	0.9679	99.8	0.36	Contact Map
1o50A	2	0.8397	99.8	0.361	Contact Map
2qrdG	1	0.9744	99.8	0.365	Contact Map
2nycA	2	0.7949	99.8	0.365	Contact Map
3fhmA	2	0.8333	99.8	0.367	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.