Q97TZ3 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97TZ3 - Uncharacterized protein

UniProt:	Q97TZ3	Sequences: MDLIITFGLLTLVVLLEFIVVPAIILKRGTKFSTIYNYPIYIINSTEINAYSLTSVWGKFIVLTRGLVNGEDEEHIKAAIMHEVGHLKLNHHVKMSLYIISVIMVFTYLLGVNMLTLIPFALVALLVQRYLQRRLELGADRFALRFINKKMLEDLITKYDMKETTFLSTHPNIHVRLKNINE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	182 (157)
Sequences:	6521 (4275)
Seq/√Len:	341.1

ECOLI - YCAL LOIP BEPA HTPX
BACSU - HTPX
HALSA - HTPX
SULSO - Q97TZ3 Q97VD5 HTPX1 HTPX2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
44_N	64_T	3.766	1.00
85_G	142_F	3.580	1.00
157_T	181_N	3.364	1.00
165_T	175_V	3.025	1.00
62_V	80_I	2.965	1.00
75_H	158_K	2.644	1.00
22_P	26_L	2.432	1.00
39_P	59_K	2.428	1.00
137_L	175_V	2.421	1.00
71_E	158_K	2.359	1.00
89_L	142_F	2.336	1.00
137_L	179_N	2.300	1.00
81_M	143_A	2.212	1.00
141_R	179_N	2.099	1.00
24_I	28_R	2.078	1.00
143_A	147_I	1.994	1.00
141_R	145_R	1.865	1.00
22_P	25_I	1.817	1.00
175_V	178_K	1.758	1.00
91_H	138_G	1.688	1.00
75_H	154_D	1.680	1.00
22_P	28_R	1.645	1.00
154_D	157_T	1.638	1.00
51_Y	61_I	1.638	1.00
43_I	61_I	1.634	1.00
157_T	177_L	1.623	1.00
52_S	87_L	1.600	1.00
88_K	146_F	1.591	1.00
70_G	76_I	1.579	1.00
46_T	68_V	1.560	1.00
25_I	28_R	1.543	1.00
70_G	155_L	1.500	1.00
25_I	40_I	1.498	1.00
90_N	93_V	1.495	1.00
95_M	135_L	1.472	1.00
74_E	149_K	1.423	1.00
142_F	146_F	1.418	1.00
30_T	33_S	1.394	1.00
54_T	92_H	1.384	1.00
62_V	76_I	1.325	1.00
74_E	152_L	1.325	1.00
64_T	68_V	1.324	1.00
24_I	27_K	1.323	1.00
23_A	27_K	1.321	1.00
174_H	178_K	1.303	1.00
71_E	75_H	1.302	1.00
111_G	114_M	1.301	1.00
178_K	181_N	1.299	1.00
47_E	63_L	1.297	1.00
172_N	175_V	1.291	1.00
35_I	38_Y	1.266	1.00
33_S	36_Y	1.261	1.00
138_G	142_F	1.238	1.00
48_I	69_N	1.237	1.00
77_K	152_L	1.220	1.00
85_G	89_L	1.211	1.00
175_V	179_N	1.188	1.00
154_D	158_K	1.179	1.00
85_G	146_F	1.168	1.00
134_R	137_L	1.153	1.00
101_S	105_V	1.139	1.00
106_F	110_L	1.105	1.00
144_L	180_I	1.105	1.00
88_K	142_F	1.100	1.00
147_I	152_L	1.095	1.00
31_K	34_T	1.085	1.00
30_T	34_T	1.081	1.00
45_S	63_L	1.081	1.00
41_Y	59_K	1.078	1.00
168_S	172_N	1.078	1.00
130_Y	133_R	1.076	1.00
48_I	63_L	1.075	1.00
40_I	60_F	1.071	1.00
156_I	159_Y	1.069	1.00
145_R	149_K	1.052	1.00
52_S	61_I	1.049	1.00
125_L	129_R	1.048	1.00
78_A	147_I	1.020	1.00
164_T	167_L	1.019	1.00
97_L	101_S	1.012	1.00
89_L	138_G	0.997	1.00
29_G	32_F	0.988	1.00
107_T	110_L	0.988	1.00
129_R	169_T	0.980	1.00
23_A	26_L	0.980	1.00
29_G	77_K	0.978	1.00
78_A	155_L	0.978	1.00
125_L	130_Y	0.963	1.00
30_T	35_I	0.961	1.00
98_Y	135_L	0.961	1.00
123_V	126_L	0.955	1.00
132_Q	135_L	0.952	1.00
165_T	172_N	0.952	1.00
102_V	106_F	0.950	1.00
173_I	177_L	0.945	1.00
67_L	76_I	0.929	1.00
22_P	27_K	0.927	1.00
66_G	79_A	0.921	1.00
29_G	33_S	0.919	1.00
46_T	64_T	0.902	1.00
102_V	128_Q	0.895	1.00
127_V	131_L	0.890	1.00
124_A	128_Q	0.885	1.00
130_Y	134_R	0.884	1.00
144_L	148_N	0.879	1.00
114_M	118_I	0.875	1.00
77_K	149_K	0.873	1.00
79_A	155_L	0.862	1.00
137_L	141_R	0.851	1.00
118_I	121_A	0.849	1.00
55_S	58_G	0.840	1.00
105_V	109_L	0.839	1.00
41_Y	61_I	0.836	1.00
62_V	66_G	0.822	1.00
55_S	59_K	0.820	1.00
38_Y	88_K	0.820	1.00
149_K	152_L	0.818	1.00
95_M	98_Y	0.809	1.00
112_V	115_L	0.801	1.00
68_V	75_H	0.793	1.00
94_K	135_L	0.788	1.00
74_E	151_M	0.782	1.00
120_F	124_A	0.778	1.00
29_G	34_T	0.777	1.00
53_L	59_K	0.773	1.00
103_I	107_T	0.766	1.00
42_I	67_L	0.765	1.00
123_V	127_V	0.762	1.00
30_T	38_Y	0.761	1.00
129_R	133_R	0.759	1.00
28_R	84_V	0.756	1.00
98_Y	102_V	0.751	1.00
91_H	135_L	0.749	1.00
125_L	128_Q	0.745	1.00
119_P	122_L	0.737	0.99
121_A	124_A	0.737	0.99
54_T	58_G	0.737	0.99
95_M	131_L	0.734	0.99
58_G	87_L	0.732	0.99
138_G	141_R	0.731	0.99
118_I	122_L	0.730	0.99
34_T	38_Y	0.728	0.99
23_A	28_R	0.728	0.99
161_M	164_T	0.720	0.99
113_N	117_L	0.714	0.99
155_L	173_I	0.711	0.99
66_G	75_H	0.710	0.99
31_K	35_I	0.705	0.99
94_K	97_L	0.705	0.99
116_T	119_P	0.704	0.99
94_K	138_G	0.699	0.99
159_Y	173_I	0.699	0.99
91_H	94_K	0.693	0.99
29_G	38_Y	0.692	0.99
73_E	152_L	0.691	0.99
113_N	120_F	0.690	0.99
43_I	64_T	0.689	0.99
117_L	121_A	0.687	0.99
29_G	35_I	0.686	0.99
163_E	168_S	0.686	0.99
92_H	96_S	0.681	0.99
112_V	119_P	0.678	0.99
62_V	67_L	0.678	0.99
129_R	132_Q	0.674	0.99
147_I	150_K	0.674	0.99
164_T	168_S	0.669	0.99
93_V	97_L	0.667	0.99
150_K	153_E	0.664	0.99
52_S	60_F	0.658	0.99
147_I	153_E	0.651	0.99
143_A	150_K	0.646	0.99
124_A	129_R	0.644	0.99
160_D	164_T	0.641	0.99
49_N	52_S	0.639	0.99
165_T	168_S	0.638	0.98
85_G	88_K	0.635	0.98
78_A	156_I	0.631	0.98
84_V	87_L	0.628	0.98
92_H	95_M	0.628	0.98
88_K	145_R	0.623	0.98
53_L	93_V	0.623	0.98
113_N	116_T	0.622	0.98
53_L	61_I	0.619	0.98
156_I	173_I	0.618	0.98
114_M	117_L	0.615	0.98
99_I	103_I	0.615	0.98
29_G	36_Y	0.614	0.98
129_R	168_S	0.613	0.98
70_G	158_K	0.612	0.98
177_L	181_N	0.610	0.98
164_T	175_V	0.606	0.98
112_V	116_T	0.602	0.98
31_K	36_Y	0.592	0.98
144_L	156_I	0.592	0.98
151_M	181_N	0.590	0.97
162_K	173_I	0.589	0.97
69_N	158_K	0.586	0.97
104_M	108_Y	0.576	0.97
100_I	104_M	0.572	0.97
68_V	71_E	0.571	0.97
162_K	165_T	0.570	0.97
125_L	167_L	0.570	0.97
48_I	65_R	0.568	0.97
116_T	120_F	0.568	0.97
160_D	163_E	0.567	0.97
156_I	177_L	0.564	0.97
129_R	172_N	0.561	0.97
155_L	158_K	0.559	0.97
99_I	128_Q	0.558	0.97
66_G	70_G	0.556	0.96
60_F	66_G	0.553	0.96
120_F	126_L	0.548	0.96
33_S	38_Y	0.545	0.96
78_A	180_I	0.542	0.96
162_K	168_S	0.541	0.96
103_I	106_F	0.536	0.96
25_I	29_G	0.535	0.96
40_I	84_V	0.535	0.96
36_Y	87_L	0.532	0.95
66_G	76_I	0.530	0.95
134_R	138_G	0.530	0.95
30_T	150_K	0.528	0.95
45_S	64_T	0.523	0.95
30_T	36_Y	0.522	0.95
121_A	125_L	0.517	0.95
78_A	153_E	0.515	0.95
45_S	65_R	0.514	0.95
122_L	125_L	0.511	0.94
119_P	123_V	0.510	0.94
101_S	104_M	0.510	0.94
102_V	105_V	0.509	0.94
34_T	37_N	0.508	0.94
98_Y	134_R	0.507	0.94
98_Y	127_V	0.504	0.94
162_K	172_N	0.503	0.94
53_L	92_H	0.500	0.94

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3c37A	1	0.9396	100	0.307	Contact Map
4il3A	1	0.978	99.9	0.455	Contact Map
4aw6A	2	0.9835	99.9	0.457	Contact Map
3cqbA	4	0.5385	99.5	0.672	Contact Map
3dteA	2	0.7692	96.7	0.851	Contact Map
4qhjA	2	0.5604	95.1	0.871	Contact Map
4jixA	2	0.5989	95	0.872	Contact Map
4jiuA	1	0.5604	86	0.898	Contact Map
4iuwA	1	0.9231	69.1	0.913	Contact Map
1r1hA	1	0.9451	66.6	0.914	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.