Q97TZ1 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97TZ1 - Uncharacterized protein

UniProt:	Q97TZ1	Sequences: MQRHVMSSKDSKIFINKIKEKYNVDISNAKLEVGKEKKEIWYYVNDILAFFDDLIPTLCAIIRLKINLPYVIIDEGAVKAVSKGADLFAPGIVEYNCECKENEIVLAKTKTNLPVAVLRVLMPKEKALVEKKGKFALNLHHIGDKIWEMCNG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	152 (146)
Sequences:	740 (509)
Seq/√Len:	42.1

HALSA - Q9HM93
SULSO - Q97TZ1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
86_D	134_K	3.565	1.00
42_Y	54_L	3.454	1.00
47_I	63_R	3.381	1.00
61_I	106_L	2.932	1.00
89_A	135_F	2.906	1.00
8_S	12_K	2.772	1.00
123_P	126_K	2.613	1.00
99_C	120_V	2.607	1.00
118_L	136_A	2.602	1.00
121_L	137_L	2.382	1.00
101_E	126_K	2.302	1.00
125_E	129_V	2.262	1.00
74_D	77_A	2.244	1.00
81_V	87_L	2.237	1.00
29_A	45_N	2.209	1.00
62_I	114_P	2.203	1.00
71_V	136_A	2.067	0.99
120_V	127_A	2.015	0.99
71_V	99_C	2.002	0.99
17_K	20_E	1.959	0.99
100_K	123_P	1.947	0.99
101_E	121_L	1.870	0.99
61_I	68_L	1.734	0.98
55_I	104_I	1.731	0.98
89_A	131_K	1.643	0.97
100_K	103_E	1.586	0.96
119_R	137_L	1.541	0.95
16_N	20_E	1.484	0.94
90_P	132_K	1.472	0.94
75_E	108_K	1.454	0.93
99_C	124_K	1.437	0.93
6_M	12_K	1.416	0.92
34_G	43_Y	1.384	0.92
28_N	35_K	1.379	0.91
102_N	120_V	1.360	0.91
71_V	105_V	1.335	0.90
95_Y	124_K	1.312	0.89
68_L	106_L	1.294	0.89
86_D	137_L	1.289	0.88
77_A	80_A	1.285	0.88
10_D	13_I	1.238	0.86
98_E	103_E	1.214	0.85
14_F	54_L	1.209	0.85
120_V	124_K	1.202	0.84
81_V	116_A	1.200	0.84
15_I	19_K	1.193	0.84
14_F	42_Y	1.192	0.84
104_I	119_R	1.190	0.84
73_I	80_A	1.177	0.83
84_G	91_G	1.176	0.83
100_K	125_E	1.174	0.83
107_A	116_A	1.163	0.82
73_I	115_V	1.140	0.81
114_P	147_W	1.138	0.81
23_N	43_Y	1.134	0.81
22_Y	55_I	1.129	0.81
97_C	124_K	1.123	0.80
101_E	128_L	1.108	0.79
81_V	138_N	1.100	0.79
41_W	48_L	1.100	0.79
55_I	139_L	1.093	0.78
72_I	98_E	1.073	0.77
111_T	142_I	1.066	0.77
78_V	108_K	1.062	0.76
133_G	140_H	1.062	0.76
16_N	19_K	1.051	0.76
108_K	111_T	1.033	0.74
80_A	85_A	1.032	0.74
73_I	87_L	1.030	0.74
80_A	88_F	1.028	0.74
120_V	136_A	1.025	0.74
33_V	40_I	1.024	0.74
85_A	133_G	1.021	0.73
103_E	120_V	1.021	0.73
88_F	91_G	1.015	0.73
7_S	115_V	1.014	0.73
55_I	119_R	1.004	0.72
6_M	102_N	1.004	0.72
105_V	136_A	0.990	0.71
42_Y	143_G	0.979	0.70
76_G	141_H	0.973	0.70
42_Y	87_L	0.962	0.69
97_C	135_F	0.959	0.69
49_A	60_A	0.958	0.68
71_V	120_V	0.950	0.68
27_S	30_K	0.938	0.67
78_V	82_S	0.931	0.66
9_K	12_K	0.922	0.66
122_M	135_F	0.917	0.65
8_S	21_K	0.914	0.65
80_A	83_K	0.906	0.64
61_I	67_N	0.895	0.63
78_V	105_V	0.883	0.62
42_Y	75_E	0.882	0.62
15_I	110_K	0.881	0.62
89_A	122_M	0.866	0.61
4_H	135_F	0.865	0.61
26_I	64_L	0.857	0.60
58_L	75_E	0.827	0.57
73_I	77_A	0.814	0.56
10_D	122_M	0.804	0.55
92_I	97_C	0.796	0.54
87_L	116_A	0.792	0.54
58_L	142_I	0.791	0.54
116_A	140_H	0.790	0.54
49_A	149_M	0.790	0.54
17_K	21_K	0.789	0.54
114_P	117_V	0.786	0.53
74_D	80_A	0.784	0.53
140_H	144_D	0.782	0.53
27_S	132_K	0.779	0.53
45_N	99_C	0.768	0.52
5_V	57_T	0.765	0.51
6_M	40_I	0.764	0.51
59_C	62_I	0.763	0.51
76_G	80_A	0.761	0.51
32_E	43_Y	0.760	0.51
28_N	33_V	0.756	0.50
47_I	139_L	0.754	0.50
48_L	138_N	0.751	0.50
10_D	102_N	0.751	0.50
133_G	144_D	0.739	0.49
104_I	139_L	0.739	0.49
123_P	139_L	0.732	0.48
68_L	104_I	0.726	0.48
79_K	147_W	0.725	0.47
12_K	81_V	0.723	0.47
115_V	135_F	0.722	0.47
86_D	116_A	0.720	0.47
47_I	59_C	0.717	0.47
101_E	130_E	0.709	0.46
103_E	127_A	0.706	0.46
53_D	114_P	0.703	0.45
50_F	56_P	0.702	0.45
11_S	132_K	0.694	0.45
17_K	117_V	0.686	0.44
77_A	87_L	0.686	0.44
46_D	148_E	0.686	0.44
12_K	52_D	0.683	0.44
30_K	33_V	0.681	0.43
43_Y	101_E	0.672	0.43
54_L	68_L	0.672	0.43
54_L	106_L	0.672	0.43
51_F	57_T	0.670	0.42
74_D	109_T	0.669	0.42
138_N	141_H	0.666	0.42
20_E	23_N	0.665	0.42
126_K	129_V	0.665	0.42
89_A	92_I	0.663	0.42
106_L	146_I	0.663	0.42
89_A	130_E	0.662	0.42
30_K	36_E	0.657	0.41
5_V	32_E	0.650	0.41
6_M	90_P	0.648	0.40
10_D	107_A	0.643	0.40
73_I	76_G	0.639	0.40
46_D	71_V	0.637	0.39
25_D	67_N	0.633	0.39
69_P	96_N	0.633	0.39
91_G	118_L	0.632	0.39
12_K	97_C	0.631	0.39
73_I	138_N	0.631	0.39
74_D	89_A	0.630	0.39
16_N	54_L	0.627	0.38
75_E	78_V	0.626	0.38
72_I	96_N	0.624	0.38
95_Y	127_A	0.622	0.38
74_D	94_E	0.620	0.38
75_E	109_T	0.617	0.38
36_E	45_N	0.616	0.37
32_E	44_V	0.613	0.37
74_D	93_V	0.613	0.37
18_I	85_A	0.613	0.37
131_K	142_I	0.612	0.37
87_L	136_A	0.606	0.37
30_K	44_V	0.603	0.36
83_K	115_V	0.602	0.36
10_D	16_N	0.599	0.36
69_P	79_K	0.598	0.36
13_I	107_A	0.596	0.36
31_L	147_W	0.593	0.35
89_A	93_V	0.588	0.35
59_C	147_W	0.581	0.34
102_N	119_R	0.577	0.34
87_L	140_H	0.577	0.34
51_F	93_V	0.577	0.34
132_K	147_W	0.576	0.34
45_N	148_E	0.575	0.34
74_D	78_V	0.573	0.34
85_A	104_I	0.573	0.34
14_F	71_V	0.571	0.34
59_C	139_L	0.568	0.33
95_Y	143_G	0.567	0.33
51_F	56_P	0.556	0.32
102_N	129_V	0.554	0.32
45_N	126_K	0.554	0.32
75_E	143_G	0.553	0.32
49_A	121_L	0.543	0.31
34_G	55_I	0.542	0.31
95_Y	99_C	0.542	0.31
34_G	46_D	0.536	0.31
34_G	41_W	0.534	0.31
82_S	110_K	0.531	0.30
71_V	143_G	0.529	0.30
92_I	96_N	0.527	0.30
132_K	141_H	0.524	0.30
117_V	139_L	0.520	0.29
12_K	40_I	0.518	0.29
92_I	120_V	0.518	0.29
23_N	26_I	0.515	0.29
24_V	128_L	0.511	0.29
99_C	128_L	0.509	0.29
31_L	50_F	0.508	0.29
60_A	99_C	0.507	0.28
43_Y	107_A	0.505	0.28
63_R	83_K	0.504	0.28
88_F	118_L	0.504	0.28
67_N	106_L	0.502	0.28
55_I	117_V	0.500	0.28

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1q7hA	2	0.9803	100	0.294	Contact Map
3d79A	1	0.9868	100	0.303	Contact Map
3r90A	5	1	100	0.311	Contact Map
2cx0A	1	1	100	0.355	Contact Map
1iq8A	2	0.9079	99.9	0.521	Contact Map
2q07A	1	0.8553	99.9	0.528	Contact Map
2p38A	4	0.8487	99.9	0.586	Contact Map
3zv0C	2	0.8289	99.8	0.605	Contact Map
2apoA	1	0.9013	99	0.769	Contact Map
2ausC	1	0.9276	98.9	0.773	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.