Q97TY4 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97TY4 - Uncharacterized protein

UniProt:	Q97TY4	Sequences: MEVIDPHARVADLVGLLYSLENTFNGKTDLYMLEKEMEVDLDDLMPIVYTANSLGFITVGEGDIIITDKGIEFLKSNLKRRKEIIKDSIKKIEPFKTTLELKYFTIEELKYVLEKKGIQVYNSPEGLYDLQITLVEWGVYSGLLKKEGERFIVVTT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	156 (145)
Sequences:	348 (257)
Seq/√Len:	21.3

SULSO - Q97TY4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
29_D	63_D	5.125	1.00
31_Y	63_D	3.378	1.00
17_L	74_L	2.961	0.99
55_G	92_I	2.910	0.99
69_K	88_S	2.854	0.99
29_D	62_G	2.790	0.99
30_L	64_I	2.784	0.99
82_K	142_G	2.698	0.99
111_Y	115_K	2.453	0.98
76_S	84_I	2.432	0.97
109_L	120_V	2.397	0.97
27_K	63_D	2.166	0.95
57_I	64_I	2.149	0.95
104_F	109_L	2.139	0.94
122_N	130_L	2.138	0.94
76_S	83_E	2.058	0.93
48_V	64_I	2.030	0.93
113_L	117_G	1.892	0.90
43_D	46_P	1.877	0.89
41_L	46_P	1.867	0.89
14_V	134_L	1.830	0.88
13_L	74_L	1.797	0.87
95_F	99_L	1.781	0.87
109_L	113_L	1.708	0.84
109_L	114_E	1.699	0.84
102_K	107_E	1.673	0.83
86_K	141_S	1.669	0.83
99_L	131_Q	1.653	0.82
17_L	20_L	1.647	0.82
62_G	127_L	1.633	0.82
20_L	101_L	1.569	0.79
61_E	87_D	1.564	0.79
113_L	120_V	1.535	0.77
78_L	82_K	1.461	0.74
121_Y	133_T	1.394	0.70
68_D	83_E	1.389	0.70
105_T	114_E	1.387	0.70
24_F	28_T	1.385	0.69
85_I	140_Y	1.374	0.69
16_L	86_K	1.343	0.67
47_I	86_K	1.323	0.66
5_D	118_I	1.322	0.66
134_L	144_L	1.322	0.66
104_F	113_L	1.318	0.65
131_Q	135_V	1.306	0.65
29_D	64_I	1.265	0.62
104_F	120_V	1.220	0.59
115_K	126_G	1.206	0.58
42_D	46_P	1.198	0.58
20_L	116_K	1.168	0.56
51_A	57_I	1.153	0.55
47_I	143_L	1.138	0.54
67_T	70_G	1.130	0.53
73_F	141_S	1.128	0.53
10_V	112_V	1.118	0.53
73_F	121_Y	1.110	0.52
10_V	136_E	1.104	0.52
108_E	128_Y	1.090	0.51
104_F	117_G	1.087	0.51
19_S	88_S	1.085	0.50
11_A	14_V	1.053	0.48
85_I	93_E	1.053	0.48
27_K	84_I	1.053	0.48
78_L	112_V	1.043	0.48
87_D	145_K	1.037	0.47
39_V	121_Y	1.036	0.47
93_E	96_K	1.031	0.47
20_L	81_R	1.022	0.46
56_F	72_E	1.014	0.46
80_R	83_E	1.005	0.45
27_K	65_I	0.991	0.44
18_Y	122_N	0.985	0.44
43_D	80_R	0.980	0.43
88_S	92_I	0.979	0.43
13_L	50_T	0.979	0.43
11_A	40_D	0.969	0.43
34_E	54_L	0.967	0.43
109_L	117_G	0.956	0.42
68_D	128_Y	0.950	0.41
118_I	127_L	0.946	0.41
70_G	143_L	0.932	0.40
112_V	116_K	0.929	0.40
113_L	130_L	0.927	0.40
58_T	65_I	0.906	0.39
89_I	100_E	0.903	0.38
55_G	88_S	0.900	0.38
41_L	123_S	0.896	0.38
67_T	73_F	0.884	0.37
16_L	40_D	0.884	0.37
35_K	90_K	0.880	0.37
56_F	88_S	0.879	0.37
28_T	51_A	0.877	0.37
36_E	67_T	0.873	0.37
71_I	75_K	0.859	0.36
81_R	89_I	0.852	0.35
43_D	132_I	0.849	0.35
7_H	83_E	0.844	0.35
8_A	26_G	0.842	0.35
31_Y	95_F	0.841	0.35
33_L	115_K	0.826	0.34
59_V	62_G	0.820	0.33
17_L	56_F	0.815	0.33
7_H	133_T	0.811	0.33
30_L	70_G	0.806	0.32
5_D	127_L	0.794	0.32
48_V	59_V	0.782	0.31
106_I	125_E	0.778	0.31
95_F	134_L	0.775	0.31
16_L	136_E	0.770	0.30
76_S	149_E	0.769	0.30
10_V	16_L	0.768	0.30
46_P	57_I	0.768	0.30
44_L	123_S	0.768	0.30
31_Y	94_P	0.764	0.30
96_K	134_L	0.762	0.30
68_D	71_I	0.762	0.30
12_D	49_Y	0.761	0.30
96_K	99_L	0.758	0.30
67_T	76_S	0.755	0.30
48_V	58_T	0.751	0.29
133_T	138_G	0.743	0.29
122_N	126_G	0.737	0.29
79_K	132_I	0.736	0.29
14_V	79_K	0.734	0.28
114_E	135_V	0.729	0.28
52_N	66_I	0.728	0.28
75_K	135_V	0.713	0.27
63_D	141_S	0.709	0.27
94_P	99_L	0.704	0.27
19_S	109_L	0.700	0.27
6_P	129_D	0.700	0.27
78_L	142_G	0.699	0.27
95_F	101_L	0.697	0.26
68_D	75_K	0.692	0.26
114_E	139_V	0.691	0.26
115_K	135_V	0.691	0.26
101_L	128_Y	0.690	0.26
59_V	126_G	0.686	0.26
116_K	147_E	0.684	0.26
23_T	144_L	0.682	0.26
7_H	18_Y	0.679	0.26
50_T	133_T	0.676	0.25
40_D	82_K	0.669	0.25
14_V	142_G	0.665	0.25
104_F	130_L	0.663	0.25
22_N	125_E	0.661	0.25
24_F	36_E	0.656	0.24
60_G	71_I	0.650	0.24
5_D	139_V	0.644	0.24
59_V	129_D	0.640	0.24
31_Y	34_E	0.640	0.24
7_H	25_N	0.636	0.23
49_Y	59_V	0.633	0.23
16_L	133_T	0.632	0.23
49_Y	142_G	0.630	0.23
27_K	131_Q	0.625	0.23
16_L	42_D	0.624	0.23
25_N	76_S	0.621	0.23
6_P	53_S	0.618	0.23
26_G	87_D	0.609	0.22
30_L	48_V	0.607	0.22
56_F	64_I	0.602	0.22
66_I	131_Q	0.601	0.22
111_Y	148_G	0.598	0.22
11_A	145_K	0.595	0.21
40_D	67_T	0.594	0.21
20_L	43_D	0.591	0.21
20_L	98_T	0.588	0.21
58_T	83_E	0.583	0.21
88_S	115_K	0.577	0.21
38_E	53_S	0.576	0.21
40_D	129_D	0.573	0.21
25_N	132_I	0.570	0.20
71_I	83_E	0.570	0.20
111_Y	132_I	0.569	0.20
52_N	119_Q	0.566	0.20
84_I	106_I	0.565	0.20
23_T	28_T	0.562	0.20
48_V	130_L	0.561	0.20
78_L	116_K	0.557	0.20
119_Q	127_L	0.553	0.20
90_K	110_K	0.548	0.19
17_L	39_V	0.547	0.19
107_E	141_S	0.547	0.19
7_H	149_E	0.545	0.19
46_P	135_V	0.544	0.19
14_V	78_L	0.544	0.19
22_N	107_E	0.543	0.19
19_S	102_K	0.537	0.19
116_K	130_L	0.532	0.19
27_K	43_D	0.532	0.19
69_K	87_D	0.530	0.19
9_R	104_F	0.527	0.19
112_V	128_Y	0.526	0.19
108_E	143_L	0.525	0.18
122_N	136_E	0.525	0.18
93_E	127_L	0.522	0.18
77_N	83_E	0.521	0.18
92_I	95_F	0.520	0.18
18_Y	53_S	0.520	0.18
23_T	27_K	0.519	0.18
74_L	114_E	0.517	0.18
135_V	146_K	0.517	0.18
66_I	146_K	0.516	0.18
17_L	84_I	0.514	0.18
63_D	73_F	0.510	0.18
51_A	103_Y	0.510	0.18
136_E	144_L	0.508	0.18
9_R	40_D	0.507	0.18
83_E	97_T	0.505	0.18
33_L	150_R	0.505	0.18
127_L	146_K	0.505	0.18
76_S	86_K	0.504	0.18
110_K	120_V	0.503	0.18
17_L	135_V	0.502	0.18
104_F	114_E	0.502	0.18
42_D	78_L	0.501	0.18
12_D	82_K	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1bjaA	1	0.5641	86.3	0.911	Contact Map
2o0mA	1	0.4487	80.2	0.918	Contact Map
1p4xA	1	0.609	78.7	0.919	Contact Map
1r7jA	2	0.5449	76.6	0.92	Contact Map
2wteA	2	0.5064	75.1	0.921	Contact Map
1hsjA	2	0.5513	74.6	0.922	Contact Map
2qvoA	2	0.5064	73.8	0.922	Contact Map
2pg4A	3	0.5385	73	0.923	Contact Map
3nqoA	2	0.8782	71.4	0.923	Contact Map
2fxaA	4	0.8654	70.3	0.924	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.