Q97TX3 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97TX3 - Second ORF in transposon ISC1229

UniProt:	Q97TX3	Sequences: MKSKNFPEILVLLTISGIGKLAAGIIIGIVGDIRRFPRPESFVAYCGLDPVVERSGRIEVRKGISKRGNKYLRSLFYFLAETQYSRNPTLLKLHEAHKDKLKGRKLYTALARKLARIVWSVWYNNKPYEVK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	131 (123)
Sequences:	3905 (2612)
Seq/√Len:	235.5

SULSO - Q97TX3 Q7LXX5 Q97UF7 Q97X29 Q97X12 Q97Y06 Q97Z62 Q97UQ6 Q97YE1 Q97ZN4 Q97WZ5 Q97XV5 Q97X07 Q97Y59 Q97WY7 Q97VS0 Q97WC0 Q97XK2 Q97X26 Q97VB2 Q97XR9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
98_K	103_G	2.621	1.00
11_V	127_P	2.401	1.00
101_L	105_K	2.386	1.00
97_H	100_K	2.346	1.00
14_T	127_P	2.304	1.00
102_K	105_K	2.223	1.00
26_I	118_V	2.171	1.00
42_F	115_A	2.170	1.00
7_P	125_N	2.122	1.00
112_R	116_R	2.062	1.00
46_C	72_L	2.003	1.00
30_V	42_F	1.981	1.00
64_I	108_T	1.978	1.00
37_P	41_S	1.923	1.00
54_R	59_E	1.849	1.00
46_C	115_A	1.775	1.00
91_L	95_E	1.770	1.00
48_L	111_A	1.748	1.00
25_I	75_L	1.745	1.00
38_R	41_S	1.738	1.00
120_S	124_N	1.725	1.00
13_L	20_K	1.696	1.00
11_V	121_V	1.696	1.00
90_L	110_L	1.667	1.00
18_I	23_A	1.658	1.00
43_V	49_D	1.630	1.00
126_K	129_E	1.616	1.00
93_L	113_K	1.558	1.00
8_E	125_N	1.552	1.00
78_F	81_E	1.537	1.00
15_I	118_V	1.520	1.00
119_W	123_Y	1.513	1.00
22_A	75_L	1.503	1.00
8_E	122_W	1.502	1.00
96_A	100_K	1.481	1.00
36_F	45_Y	1.475	1.00
11_V	14_T	1.454	1.00
12_L	118_V	1.449	1.00
22_A	79_L	1.443	1.00
90_L	117_I	1.410	1.00
94_H	110_L	1.381	1.00
117_I	121_V	1.325	1.00
121_V	127_P	1.312	1.00
43_V	112_R	1.309	1.00
15_I	121_V	1.289	1.00
7_P	11_V	1.273	1.00
29_I	69_N	1.248	1.00
77_Y	111_A	1.242	1.00
80_A	110_L	1.237	1.00
15_I	114_L	1.235	1.00
33_I	122_W	1.171	1.00
30_V	33_I	1.156	1.00
93_L	97_H	1.153	1.00
97_H	106_L	1.150	1.00
29_I	71_Y	1.124	1.00
80_A	111_A	1.122	1.00
93_L	96_A	1.101	1.00
93_L	110_L	1.092	1.00
88_P	92_K	1.091	1.00
76_F	115_A	1.085	1.00
77_Y	81_E	1.079	1.00
9_I	13_L	1.051	1.00
81_E	103_G	1.037	1.00
55_S	59_E	1.017	1.00
95_E	99_D	1.015	1.00
94_H	106_L	1.012	1.00
77_Y	108_T	0.998	1.00
79_L	114_L	0.972	1.00
88_P	91_L	0.970	1.00
74_S	78_F	0.955	1.00
102_K	106_L	0.954	1.00
81_E	104_R	0.952	1.00
51_V	65_S	0.943	1.00
77_Y	104_R	0.933	1.00
52_V	59_E	0.933	1.00
96_A	99_D	0.931	1.00
97_H	101_L	0.918	1.00
18_I	22_A	0.916	1.00
18_I	118_V	0.895	0.99
92_K	96_A	0.882	0.99
13_L	23_A	0.880	0.99
118_V	121_V	0.872	0.99
81_E	84_Y	0.868	0.99
84_Y	94_H	0.868	0.99
26_I	72_L	0.867	0.99
78_F	104_R	0.849	0.99
90_L	114_L	0.828	0.99
103_G	107_Y	0.818	0.99
64_I	73_R	0.814	0.99
92_K	95_E	0.807	0.99
12_L	122_W	0.791	0.99
120_S	123_Y	0.786	0.99
89_T	128_Y	0.785	0.99
108_T	111_A	0.776	0.99
11_V	125_N	0.775	0.99
98_K	106_L	0.771	0.98
45_Y	69_N	0.768	0.98
86_R	91_L	0.766	0.98
54_R	60_V	0.762	0.98
80_A	107_Y	0.761	0.98
104_R	107_Y	0.758	0.98
81_E	107_Y	0.755	0.98
9_I	27_I	0.749	0.98
121_V	126_K	0.749	0.98
40_E	112_R	0.748	0.98
36_F	42_F	0.746	0.98
49_D	65_S	0.729	0.98
94_H	98_K	0.725	0.98
49_D	66_K	0.720	0.98
21_L	25_I	0.719	0.98
66_K	73_R	0.715	0.98
64_I	109_A	0.715	0.98
63_G	105_K	0.710	0.97
94_H	103_G	0.708	0.97
9_I	24_G	0.703	0.97
18_I	114_L	0.701	0.97
75_L	79_L	0.695	0.97
12_L	23_A	0.693	0.97
97_H	109_A	0.692	0.97
68_G	73_R	0.690	0.97
7_P	10_L	0.686	0.97
38_R	119_W	0.686	0.97
79_L	111_A	0.674	0.96
83_Q	90_L	0.671	0.96
53_E	58_I	0.668	0.96
74_S	77_Y	0.661	0.96
8_E	11_V	0.661	0.96
76_F	118_V	0.658	0.96
82_T	86_R	0.655	0.96
58_I	62_K	0.652	0.96
15_I	18_I	0.652	0.96
79_L	83_Q	0.650	0.96
8_E	27_I	0.646	0.96
10_L	127_P	0.645	0.95
9_I	23_A	0.644	0.95
44_A	49_D	0.638	0.95
29_I	46_C	0.634	0.95
49_D	73_R	0.631	0.95
81_E	85_S	0.627	0.95
52_V	61_R	0.623	0.95
81_E	111_A	0.622	0.95
87_N	91_L	0.617	0.94
116_R	120_S	0.599	0.93
18_I	26_I	0.599	0.93
47_G	73_R	0.589	0.93
59_E	62_K	0.587	0.93
31_G	35_R	0.586	0.93
49_D	52_V	0.585	0.93
84_Y	98_K	0.583	0.92
87_N	92_K	0.583	0.92
9_I	20_K	0.583	0.92
80_A	114_L	0.581	0.92
53_E	62_K	0.577	0.92
41_S	44_A	0.576	0.92
98_K	101_L	0.573	0.92
24_G	71_Y	0.571	0.92
71_Y	75_L	0.565	0.91
95_E	98_K	0.563	0.91
15_I	117_I	0.563	0.91
57_R	60_V	0.559	0.91
117_I	120_S	0.558	0.91
58_I	61_R	0.556	0.91
20_K	24_G	0.552	0.90
51_V	62_K	0.552	0.90
39_P	119_W	0.549	0.90
64_I	68_G	0.545	0.90
25_I	71_Y	0.544	0.90
39_P	116_R	0.543	0.90
113_K	116_R	0.543	0.90
22_A	76_F	0.540	0.89
73_R	108_T	0.539	0.89
49_D	67_R	0.538	0.89
39_P	43_V	0.536	0.89
25_I	29_I	0.531	0.88
87_N	117_I	0.529	0.88
43_V	116_R	0.524	0.88
33_I	119_W	0.524	0.88
33_I	42_F	0.519	0.87
57_R	61_R	0.517	0.87
48_L	112_R	0.516	0.87
84_Y	107_Y	0.513	0.87
84_Y	110_L	0.510	0.86
43_V	115_A	0.509	0.86
34_R	123_Y	0.500	0.85

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3fhfA	1	0.7252	91.7	0.871	Contact Map
3n0uA	1	0.7328	90.8	0.874	Contact Map
3c65A	1	0	89.8	0.877	Contact Map
2bgwA	2	0.4962	89.6	0.877	Contact Map
3fhgA	2	0.7405	89.4	0.878	Contact Map
1kftA	1	0.4122	88.7	0.879	Contact Map
2a1jB	2	0.5115	88.2	0.88	Contact Map
1pu6A	1	0.7099	87.1	0.882	Contact Map
2lyhA	1	0.4733	86.9	0.883	Contact Map
4bxoA	1	0.4962	85.4	0.885	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.