Q97TW3 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q97TW3 - Second ORF in transposon ISC1078

UniProt:	Q97TW3	Sequences: MGEGTRGEAFKKIREGYKVHIFDESYVSYINKGKGWMKVGGGIKVNPKRKRFAVVGGITISKEGITFSYSTYKKPSLNSKDIILYLRKVIKDEKTVIVMDNARIHGNEVREFLEENGVEFVYLPPYSPDKSPAEGPWAVLKKRLYSKIYTDFETLMWDATRFLRSISKRVNDLTYSVKRCGEPWTSILSEVFLPFKV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	197 (167)
Sequences:	1830 (1399)
Seq/√Len:	108.3

SULSO - Q97TW3 Q97XI7 Q7LX66 Q97TV5 Q97XI6 Q97XL9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
78_N	99_M	3.140	1.00
56_G	137_W	2.965	1.00
21_I	97_I	2.918	1.00
79_S	109_V	2.846	1.00
79_S	108_E	2.843	1.00
75_P	107_N	2.719	1.00
111_E	115_E	2.682	1.00
24_E	141_K	2.645	1.00
27_V	51_R	2.525	1.00
57_G	64_G	2.479	1.00
68_S	156_M	2.407	1.00
162_F	165_S	2.331	1.00
98_V	123_L	2.331	1.00
74_K	77_L	2.293	1.00
87_R	116_N	2.160	1.00
140_L	162_F	2.108	1.00
80_K	84_L	1.931	1.00
26_Y	54_V	1.920	1.00
25_S	51_R	1.844	1.00
152_F	156_M	1.791	1.00
112_F	116_N	1.787	1.00
70_S	156_M	1.787	1.00
139_V	172_D	1.758	1.00
99_M	113_L	1.734	1.00
96_V	121_V	1.720	1.00
58_I	173_L	1.673	1.00
143_R	162_F	1.665	1.00
138_A	142_K	1.643	1.00
79_S	112_F	1.639	1.00
135_G	179_R	1.622	1.00
26_Y	159_A	1.610	1.00
79_S	107_N	1.607	1.00
58_I	136_P	1.576	1.00
21_I	78_N	1.518	1.00
75_P	79_S	1.506	1.00
75_P	108_E	1.503	1.00
140_L	166_I	1.501	1.00
131_S	134_E	1.489	1.00
176_S	180_C	1.439	1.00
103_R	106_G	1.433	1.00
27_V	49_R	1.423	1.00
156_M	160_T	1.399	1.00
113_L	120_F	1.388	1.00
172_D	175_Y	1.362	1.00
139_V	143_R	1.361	1.00
25_S	30_I	1.354	1.00
56_G	133_A	1.339	1.00
45_V	48_K	1.304	0.99
73_K	104_I	1.278	0.99
135_G	138_A	1.273	0.99
168_K	173_L	1.269	0.99
173_L	176_S	1.250	0.99
134_E	176_S	1.249	0.99
24_E	159_A	1.244	0.99
99_M	120_F	1.229	0.99
35_G	41_G	1.224	0.99
22_F	102_A	1.223	0.99
101_N	106_G	1.222	0.99
150_T	154_T	1.202	0.99
74_K	104_I	1.200	0.99
17_Y	94_K	1.198	0.99
14_R	17_Y	1.195	0.99
151_D	154_T	1.190	0.99
75_P	109_V	1.190	0.99
26_Y	141_K	1.185	0.99
26_Y	144_L	1.172	0.99
157_W	161_R	1.160	0.99
25_S	104_I	1.144	0.98
20_H	58_I	1.144	0.98
38_K	41_G	1.130	0.98
161_R	171_N	1.126	0.98
167_S	172_D	1.126	0.98
21_I	55_V	1.113	0.98
73_K	103_R	1.096	0.98
54_V	159_A	1.091	0.98
160_T	164_R	1.086	0.98
25_S	53_A	1.085	0.98
98_V	131_S	1.076	0.98
61_S	174_T	1.046	0.97
176_S	179_R	1.045	0.97
13_I	16_G	1.036	0.97
59_T	62_K	1.035	0.97
79_S	83_I	1.030	0.97
107_N	110_R	1.023	0.97
21_I	99_M	1.021	0.97
146_S	149_Y	1.017	0.97
20_H	98_V	1.008	0.97
113_L	118_V	0.999	0.96
99_M	122_Y	0.999	0.96
83_I	112_F	0.963	0.96
44_K	157_W	0.961	0.95
138_A	141_K	0.956	0.95
83_I	115_E	0.954	0.95
132_P	177_V	0.951	0.95
147_K	158_D	0.945	0.95
106_G	110_R	0.945	0.95
106_G	122_Y	0.945	0.95
82_I	112_F	0.939	0.95
108_E	111_E	0.938	0.95
37_M	42_G	0.930	0.95
154_T	157_W	0.929	0.95
153_E	158_D	0.928	0.95
168_K	174_T	0.928	0.95
133_A	137_W	0.926	0.94
161_R	165_S	0.925	0.94
134_E	180_C	0.924	0.94
23_D	105_H	0.922	0.94
36_W	142_K	0.917	0.94
48_K	51_R	0.913	0.94
28_S	155_L	0.912	0.94
175_Y	178_K	0.904	0.94
171_N	175_Y	0.904	0.94
21_I	123_L	0.899	0.94
69_Y	73_K	0.893	0.93
111_E	114_E	0.887	0.93
94_K	119_E	0.880	0.93
85_Y	88_K	0.876	0.93
73_K	81_D	0.876	0.93
78_N	106_G	0.873	0.93
171_N	178_K	0.854	0.92
73_K	77_L	0.851	0.92
115_E	153_E	0.848	0.91
140_L	176_S	0.846	0.91
15_E	180_C	0.833	0.91
24_E	29_Y	0.827	0.90
63_E	137_W	0.826	0.90
123_L	131_S	0.823	0.90
40_G	128_P	0.820	0.90
12_K	16_G	0.816	0.90
171_N	174_T	0.812	0.90
37_M	41_G	0.809	0.89
21_I	57_G	0.800	0.89
78_N	129_D	0.777	0.87
76_S	80_K	0.774	0.87
174_T	178_K	0.773	0.87
78_N	81_D	0.768	0.87
53_A	72_Y	0.766	0.87
109_V	122_Y	0.765	0.87
20_H	25_S	0.764	0.87
156_M	159_A	0.753	0.86
154_T	165_S	0.753	0.86
71_T	77_L	0.742	0.85
73_K	102_A	0.742	0.85
63_E	164_R	0.740	0.85
22_F	128_P	0.736	0.84
74_K	79_S	0.730	0.84
154_T	162_F	0.730	0.84
152_F	155_L	0.729	0.84
50_K	53_A	0.728	0.84
32_K	36_W	0.719	0.83
81_D	104_I	0.718	0.83
31_N	148_I	0.718	0.83
92_D	168_K	0.717	0.83
172_D	176_S	0.710	0.82
19_V	57_G	0.707	0.82
35_G	42_G	0.702	0.82
101_N	125_P	0.700	0.81
64_G	94_K	0.700	0.81
161_R	164_R	0.699	0.81
104_I	113_L	0.699	0.81
66_T	163_L	0.695	0.81
52_F	68_S	0.689	0.80
110_R	114_E	0.687	0.80
167_S	174_T	0.682	0.80
84_L	88_K	0.679	0.79
71_T	133_A	0.679	0.79
109_V	112_F	0.675	0.79
143_R	165_S	0.675	0.79
110_R	120_F	0.671	0.79
39_V	76_S	0.670	0.78
16_G	60_I	0.663	0.78
91_K	95_T	0.660	0.77
141_K	159_A	0.660	0.77
27_V	31_N	0.659	0.77
48_K	52_F	0.657	0.77
92_D	118_V	0.656	0.77
158_D	161_R	0.654	0.77
19_V	86_L	0.652	0.77
145_Y	149_Y	0.652	0.77
99_M	123_L	0.648	0.76
106_G	165_S	0.640	0.75
78_N	82_I	0.633	0.74
112_F	115_E	0.632	0.74
15_E	18_K	0.625	0.74
53_A	102_A	0.624	0.73
99_M	106_G	0.623	0.73
17_Y	121_V	0.612	0.72
73_K	127_S	0.609	0.72
92_D	95_T	0.606	0.71
99_M	125_P	0.604	0.71
98_V	134_E	0.598	0.70
92_D	96_V	0.598	0.70
12_K	114_E	0.595	0.70
20_H	180_C	0.595	0.70
35_G	38_K	0.594	0.70
111_E	116_N	0.593	0.70
17_Y	96_V	0.586	0.69
140_L	156_M	0.586	0.69
137_W	173_L	0.582	0.68
149_Y	154_T	0.573	0.67
49_R	53_A	0.572	0.67
133_A	163_L	0.571	0.67
155_L	159_A	0.570	0.67
138_A	155_L	0.570	0.67
77_L	104_I	0.568	0.66
24_E	137_W	0.567	0.66
123_L	126_Y	0.567	0.66
172_D	180_C	0.566	0.66
153_E	165_S	0.566	0.66
162_F	166_I	0.566	0.66
158_D	162_F	0.559	0.65
81_D	125_P	0.557	0.65
62_K	177_V	0.557	0.65
28_S	49_R	0.557	0.65
147_K	159_A	0.555	0.65
69_Y	160_T	0.554	0.64
51_R	54_V	0.553	0.64
25_S	37_M	0.552	0.64
70_S	164_R	0.550	0.64
173_L	177_V	0.550	0.64
113_L	116_N	0.547	0.63
144_L	162_F	0.547	0.63
161_R	174_T	0.545	0.63
44_K	47_P	0.544	0.63
135_G	176_S	0.542	0.63
55_V	123_L	0.541	0.63
48_K	104_I	0.538	0.62
123_L	179_R	0.537	0.62
147_K	150_T	0.534	0.62
85_Y	89_V	0.531	0.61
100_D	105_H	0.530	0.61
97_I	113_L	0.530	0.61
141_K	145_Y	0.529	0.61
29_Y	36_W	0.526	0.60
136_P	163_L	0.525	0.60
71_T	92_D	0.524	0.60
76_S	108_E	0.522	0.60
25_S	73_K	0.520	0.60
69_Y	77_L	0.519	0.59
62_K	173_L	0.514	0.59
92_D	121_V	0.513	0.59
47_P	53_A	0.509	0.58
13_I	17_Y	0.507	0.58
19_V	27_V	0.507	0.58
104_I	134_E	0.504	0.57
24_E	54_V	0.504	0.57
99_M	110_R	0.503	0.57
126_Y	141_K	0.501	0.57
98_V	180_C	0.500	0.57
15_E	123_L	0.500	0.57

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3f2kA	1	0.8782	100	0.265	Contact Map
4mdaA	1	0.8832	100	0.28	Contact Map
4u7bA	2	0.9848	100	0.417	Contact Map
4fcyA	4	0.8985	98.8	0.791	Contact Map
4fw1A	2	0.8376	97.2	0.861	Contact Map
4mq3A	1	0.6447	97.1	0.862	Contact Map
1c6vA	4	0.7411	97	0.864	Contact Map
1cxqA	2	0.6802	96.8	0.868	Contact Map
3l3uA	2	0.7614	96.8	0.869	Contact Map
4fw2A	2	0.7716	96.7	0.869	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.