Q7LYL6 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LYL6 - Peptidyl-prolyl cis-trans isomerase

UniProt:	Q7LYL6	Sequences: MFKNNDFIYIEYTAKIKDTGEIVDTTNEEEAKKANIYDETRNYGPRLVILGENRLIKGLEEALYNFNLNEEKTIEIPPEKAYGERDNSKIKIVPLGELRRQGITAVPNRVLRLSDGSLAVIRSVSGGRVVLDLNHPLAGRTLVYNVKVVKVLNNAKDKIMALIERRFSSKYANGFNVELDDGKKSVRITIPKDLYLVEDLQINVYSLAYEIVNYVLADYTVEVLQQYNKSTFSSS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	235 (185)
Sequences:	679 (477)
Seq/√Len:	35.1

HALSA - F2Z6G9
SULSO - Q7LYL6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
14_A	23_V	5.870	1.00
81_A	89_K	3.502	1.00
50_L	60_E	3.391	1.00
108_N	111_L	3.211	1.00
15_K	22_I	3.095	1.00
194_L	197_V	2.965	1.00
61_E	80_K	2.816	1.00
23_V	58_G	2.661	1.00
66_F	70_E	2.602	1.00
11_E	27_N	2.572	1.00
9_Y	47_L	2.467	1.00
66_F	72_K	2.341	0.99
58_G	76_I	2.301	0.99
48_V	55_L	2.284	0.99
194_L	198_E	2.210	0.99
185_S	195_Y	2.193	0.99
18_D	21_E	2.155	0.99
107_P	111_L	2.124	0.99
196_L	199_D	1.957	0.98
26_T	59_L	1.922	0.98
174_G	177_V	1.903	0.98
59_L	91_K	1.894	0.97
154_N	157_D	1.862	0.97
78_P	86_D	1.838	0.97
199_D	203_N	1.807	0.97
155_A	158_K	1.731	0.96
194_L	200_L	1.679	0.95
195_Y	200_L	1.646	0.94
11_E	26_T	1.636	0.94
197_V	200_L	1.625	0.94
14_A	58_G	1.623	0.94
51_G	82_Y	1.602	0.93
62_A	66_F	1.593	0.93
23_V	60_E	1.565	0.93
48_V	63_L	1.558	0.92
56_I	76_I	1.540	0.92
197_V	204_V	1.526	0.92
84_E	87_N	1.516	0.91
123_S	127_G	1.510	0.91
194_L	199_D	1.510	0.91
186_V	195_Y	1.505	0.91
7_F	49_I	1.481	0.90
139_G	165_R	1.458	0.90
62_A	74_I	1.456	0.90
16_I	21_E	1.444	0.89
12_Y	25_T	1.433	0.89
4_N	64_Y	1.407	0.88
195_Y	198_E	1.402	0.88
184_K	187_R	1.395	0.87
174_G	181_D	1.376	0.87
58_G	63_L	1.361	0.86
78_P	81_A	1.344	0.85
71_E	92_I	1.342	0.85
195_Y	199_D	1.341	0.85
164_E	178_E	1.339	0.85
9_Y	150_K	1.310	0.84
73_T	92_I	1.301	0.83
59_L	93_V	1.295	0.83
13_T	22_I	1.291	0.83
63_L	66_F	1.279	0.82
165_R	169_S	1.276	0.82
48_V	56_I	1.266	0.82
154_N	159_I	1.254	0.81
185_S	192_K	1.233	0.80
168_S	175_F	1.230	0.80
24_D	91_K	1.208	0.79
199_D	205_Y	1.202	0.78
66_F	146_V	1.199	0.78
71_E	94_P	1.198	0.78
13_T	20_G	1.198	0.78
183_K	199_D	1.187	0.77
131_L	148_V	1.179	0.77
163_I	199_D	1.148	0.75
178_E	182_G	1.138	0.74
195_Y	203_N	1.124	0.73
17_K	75_E	1.118	0.73
194_L	202_I	1.105	0.72
53_N	60_E	1.094	0.71
164_E	194_L	1.088	0.71
29_E	61_E	1.077	0.70
196_L	202_I	1.074	0.70
102_G	105_A	1.067	0.69
77_P	80_K	1.061	0.69
23_V	84_E	1.061	0.69
16_I	84_E	1.059	0.69
71_E	147_K	1.057	0.69
175_F	186_V	1.052	0.68
199_D	204_V	1.032	0.67
29_E	48_V	1.031	0.67
188_I	197_V	1.028	0.66
169_S	181_D	1.020	0.66
55_L	189_T	1.016	0.66
182_G	194_L	1.009	0.65
5_N	89_K	0.998	0.64
81_A	142_L	0.983	0.63
26_T	45_P	0.981	0.63
20_G	75_E	0.970	0.62
178_E	185_S	0.964	0.61
12_Y	26_T	0.963	0.61
193_D	197_V	0.959	0.61
192_K	195_Y	0.948	0.60
171_Y	182_G	0.941	0.60
128_R	139_G	0.934	0.59
120_V	124_V	0.929	0.59
103_I	109_R	0.926	0.58
61_E	77_P	0.924	0.58
25_T	29_E	0.913	0.57
163_I	186_V	0.907	0.57
110_V	113_L	0.903	0.56
56_I	60_E	0.903	0.56
26_T	91_K	0.898	0.56
103_I	173_N	0.890	0.55
105_A	112_R	0.888	0.55
176_N	181_D	0.884	0.55
20_G	69_N	0.882	0.55
55_L	63_L	0.878	0.54
25_T	46_R	0.872	0.54
78_P	141_T	0.864	0.53
196_L	203_N	0.859	0.53
58_G	78_P	0.858	0.53
199_D	202_I	0.858	0.53
7_F	47_L	0.853	0.52
160_M	180_D	0.850	0.52
10_I	140_R	0.848	0.52
22_I	68_L	0.846	0.51
157_D	160_M	0.834	0.50
108_N	112_R	0.830	0.50
14_A	17_K	0.818	0.49
186_V	194_L	0.817	0.49
127_G	142_L	0.815	0.49
200_L	204_V	0.811	0.48
14_A	91_K	0.808	0.48
96_G	99_R	0.805	0.48
119_A	162_L	0.801	0.48
81_A	88_S	0.798	0.47
57_K	62_A	0.796	0.47
23_V	78_P	0.774	0.45
71_E	137_L	0.769	0.45
8_I	48_V	0.767	0.45
124_V	134_N	0.765	0.45
14_A	56_I	0.763	0.44
23_V	81_A	0.758	0.44
124_V	128_R	0.756	0.44
78_P	178_E	0.756	0.44
5_N	53_N	0.752	0.43
192_K	197_V	0.749	0.43
56_I	64_Y	0.744	0.43
15_K	75_E	0.741	0.43
187_R	202_I	0.740	0.42
142_L	149_V	0.739	0.42
135_H	153_N	0.738	0.42
56_I	74_I	0.735	0.42
96_G	156_K	0.731	0.42
174_G	193_D	0.729	0.42
50_L	64_Y	0.718	0.41
67_N	79_E	0.703	0.39
164_E	192_K	0.702	0.39
81_A	86_D	0.701	0.39
12_Y	24_D	0.694	0.39
78_P	88_S	0.691	0.38
193_D	196_L	0.682	0.38
126_G	138_A	0.680	0.37
68_L	188_I	0.678	0.37
70_E	164_E	0.678	0.37
130_V	145_N	0.676	0.37
8_I	50_L	0.674	0.37
83_G	90_I	0.673	0.37
44_G	149_V	0.670	0.37
15_K	20_G	0.668	0.37
178_E	181_D	0.668	0.37
64_Y	77_P	0.665	0.36
102_G	106_V	0.664	0.36
62_A	70_E	0.664	0.36
70_E	145_N	0.663	0.36
119_A	128_R	0.663	0.36
60_E	81_A	0.662	0.36
70_E	126_G	0.662	0.36
107_P	110_V	0.658	0.36
112_R	151_V	0.654	0.35
102_G	112_R	0.650	0.35
16_I	87_N	0.650	0.35
186_V	192_K	0.650	0.35
128_R	132_D	0.649	0.35
139_G	143_V	0.649	0.35
73_T	90_I	0.648	0.35
107_P	118_L	0.646	0.35
136_P	149_V	0.644	0.35
142_L	170_K	0.642	0.34
119_A	131_L	0.640	0.34
110_V	118_L	0.638	0.34
12_Y	135_H	0.633	0.34
68_L	159_I	0.632	0.34
21_E	164_E	0.630	0.34
8_I	148_V	0.629	0.33
164_E	168_S	0.626	0.33
127_G	167_F	0.626	0.33
12_Y	90_I	0.625	0.33
131_L	184_K	0.625	0.33
179_L	183_K	0.622	0.33
27_N	59_L	0.617	0.33
13_T	81_A	0.616	0.32
164_E	203_N	0.616	0.32
109_R	113_L	0.614	0.32
176_N	196_L	0.614	0.32
196_L	200_L	0.611	0.32
93_V	159_I	0.609	0.32
25_T	51_G	0.608	0.32
63_L	161_A	0.607	0.32
190_I	196_L	0.605	0.32
8_I	167_F	0.605	0.32
46_R	55_L	0.604	0.32
200_L	203_N	0.604	0.32
193_D	200_L	0.602	0.31
23_V	56_I	0.601	0.31
73_T	122_R	0.600	0.31
58_G	66_F	0.599	0.31
12_Y	160_M	0.599	0.31
192_K	198_E	0.596	0.31
67_N	137_L	0.596	0.31
75_E	90_I	0.595	0.31
136_P	140_R	0.594	0.31
171_Y	197_V	0.593	0.31
72_K	148_V	0.590	0.31
178_E	192_K	0.590	0.31
117_S	150_K	0.585	0.30
93_V	156_K	0.583	0.30
129_V	141_T	0.581	0.30
47_L	68_L	0.579	0.30
73_T	161_A	0.573	0.29
21_E	88_S	0.573	0.29
85_R	133_L	0.572	0.29
24_D	59_L	0.572	0.29
8_I	63_L	0.572	0.29
79_E	188_I	0.570	0.29
43_Y	139_G	0.570	0.29
64_Y	68_L	0.567	0.29
95_L	176_N	0.566	0.29
131_L	134_N	0.566	0.29
177_V	181_D	0.565	0.29
80_K	84_E	0.565	0.29
24_D	53_N	0.558	0.28
6_D	124_V	0.558	0.28
190_I	200_L	0.557	0.28
50_L	99_R	0.556	0.28
187_R	191_P	0.555	0.28
127_G	197_V	0.554	0.28
123_S	164_E	0.553	0.28
104_T	107_P	0.547	0.28
26_T	29_E	0.546	0.27
160_M	195_Y	0.545	0.27
169_S	174_G	0.545	0.27
147_K	153_N	0.544	0.27
105_A	110_V	0.543	0.27
5_N	124_V	0.539	0.27
174_G	180_D	0.536	0.27
56_I	81_A	0.533	0.27
72_K	167_F	0.531	0.26
127_G	195_Y	0.531	0.26
64_Y	173_N	0.528	0.26
55_L	71_E	0.523	0.26
123_S	126_G	0.523	0.26
202_I	205_Y	0.523	0.26
70_E	146_V	0.523	0.26
89_K	177_V	0.522	0.26
27_N	94_P	0.522	0.26
134_N	137_L	0.521	0.26
74_I	118_L	0.520	0.26
190_I	194_L	0.519	0.26
51_G	79_E	0.517	0.26
68_L	98_L	0.514	0.25
10_I	77_P	0.509	0.25
53_N	57_K	0.509	0.25
125_S	147_K	0.506	0.25
142_L	186_V	0.506	0.25
59_L	63_L	0.505	0.25
84_E	122_R	0.503	0.25
57_K	89_K	0.500	0.24
87_N	92_I	0.500	0.24

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3prbA	2	0.9532	100	0.412	Contact Map
4it4A	5	0.6894	100	0.489	Contact Map
1ix5A	1	0.6426	100	0.496	Contact Map
1kt0A	2	0.8298	100	0.51	Contact Map
3pr9A	1	0.6383	100	0.514	Contact Map
2if4A	1	0.8723	100	0.537	Contact Map
4dt4A	1	0.6043	100	0.574	Contact Map
2kr7A	1	0.6	99.9	0.579	Contact Map
2k8iA	1	0.7064	99.9	0.583	Contact Map
2kfwA	1	0.7191	99.9	0.587	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.