Q7LY05 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LY05 - Uncharacterized protein

UniProt:	Q7LY05	Sequences: MLEHLIKISRRNWSSLKVIILAGGRGKRITLFKPFLVVCGKPLISWAFDAVNKLSDKVYLGINQSHPLFTIFKHSIFKIFPTPDISYENDVKYVVESLGPPILVLPVDIAFINNNIINNLIERCAVDMCTLKSYGSYLGVTYWTGLNFSNYTDIEVKEKLYNINTWEDYIKANKECNIL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	179 (154)
Sequences:	196 (167)
Seq/√Len:	13.5

HALSA - Q9HPL1
SULSO - Q7LY05

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
61_G	82_T	4.940	1.00
83_P	93_Y	4.413	1.00
43_L	110_A	3.452	0.99
22_A	60_L	3.226	0.98
24_G	28_R	2.848	0.96
23_G	28_R	2.848	0.96
137_Y	141_T	2.777	0.95
45_S	72_F	2.749	0.95
70_T	81_P	2.483	0.91
32_F	69_F	2.232	0.86
86_S	89_N	2.231	0.86
106_P	109_I	2.136	0.83
22_A	28_R	2.064	0.81
36_L	106_P	2.003	0.79
34_P	107_V	1.984	0.78
95_V	152_T	1.966	0.78
140_V	154_I	1.944	0.77
91_V	95_V	1.917	0.76
36_L	169_Y	1.786	0.71
30_T	169_Y	1.768	0.70
48_F	99_G	1.759	0.69
83_P	140_V	1.752	0.69
103_L	116_I	1.717	0.67
38_V	43_L	1.711	0.67
23_G	26_G	1.674	0.65
21_L	24_G	1.672	0.65
41_K	49_D	1.657	0.65
32_F	67_P	1.563	0.60
88_E	137_Y	1.466	0.55
29_I	137_Y	1.436	0.53
128_M	141_T	1.415	0.52
80_F	85_I	1.389	0.51
38_V	99_G	1.388	0.51
21_L	28_R	1.372	0.50
124_C	129_C	1.367	0.50
63_N	69_F	1.353	0.49
151_Y	169_Y	1.333	0.48
51_V	58_V	1.322	0.47
105_L	112_I	1.310	0.46
112_I	117_I	1.303	0.46
22_A	117_I	1.300	0.46
66_H	128_M	1.299	0.46
107_V	114_N	1.289	0.45
59_Y	62_I	1.284	0.45
42_P	110_A	1.266	0.44
114_N	168_D	1.265	0.44
106_P	141_T	1.254	0.44
48_F	103_L	1.245	0.43
103_L	166_W	1.231	0.42
31_L	66_H	1.229	0.42
69_F	128_M	1.224	0.42
62_I	103_L	1.201	0.41
55_S	166_W	1.199	0.41
61_G	94_V	1.197	0.41
44_I	60_L	1.191	0.40
55_S	62_I	1.182	0.40
128_M	134_Y	1.182	0.40
129_C	143_W	1.172	0.39
92_K	95_V	1.172	0.39
87_Y	101_P	1.142	0.38
157_K	163_I	1.138	0.38
113_N	116_I	1.137	0.38
51_V	111_F	1.134	0.37
40_G	163_I	1.125	0.37
44_I	142_Y	1.110	0.36
55_S	76_I	1.105	0.36
143_W	158_E	1.103	0.36
48_F	143_W	1.084	0.35
46_W	130_T	1.083	0.35
60_L	143_W	1.071	0.34
128_M	137_Y	1.070	0.34
63_N	91_V	1.067	0.34
130_T	172_A	1.053	0.33
48_F	170_I	1.048	0.33
27_K	83_P	1.047	0.33
29_I	65_S	1.047	0.33
31_L	98_L	1.029	0.32
30_T	130_T	1.015	0.32
37_V	59_Y	1.002	0.31
130_T	166_W	0.980	0.30
128_M	131_L	0.974	0.30
91_V	172_A	0.963	0.29
41_K	78_K	0.959	0.29
86_S	117_I	0.953	0.29
101_P	168_D	0.946	0.29
94_V	98_L	0.944	0.28
41_K	126_V	0.943	0.28
77_F	140_V	0.937	0.28
60_L	111_F	0.930	0.28
88_E	134_Y	0.919	0.27
38_V	42_P	0.915	0.27
50_A	110_A	0.914	0.27
69_F	141_T	0.907	0.27
90_D	108_D	0.904	0.27
106_P	143_W	0.904	0.27
109_I	137_Y	0.903	0.27
80_F	89_N	0.899	0.27
70_T	73_K	0.888	0.26
66_H	161_Y	0.887	0.26
47_A	110_A	0.883	0.26
55_S	131_L	0.869	0.25
149_S	163_I	0.865	0.25
37_V	167_E	0.859	0.25
88_E	141_T	0.857	0.25
77_F	161_Y	0.854	0.25
63_N	84_D	0.841	0.24
38_V	65_S	0.839	0.24
48_F	163_I	0.830	0.24
41_K	136_S	0.818	0.23
66_H	107_V	0.816	0.23
63_N	133_S	0.811	0.23
140_V	147_N	0.808	0.23
111_F	131_L	0.807	0.23
103_L	121_I	0.803	0.23
43_L	163_I	0.802	0.23
38_V	47_A	0.799	0.23
44_I	163_I	0.788	0.22
138_L	157_K	0.782	0.22
113_N	147_N	0.780	0.22
47_A	159_K	0.772	0.22
141_T	153_D	0.771	0.22
26_G	168_D	0.769	0.22
23_G	33_K	0.767	0.21
24_G	33_K	0.767	0.21
39_C	117_I	0.762	0.21
51_V	121_I	0.760	0.21
136_S	164_N	0.758	0.21
52_N	167_E	0.753	0.21
69_F	159_K	0.752	0.21
38_V	92_K	0.745	0.21
31_L	152_T	0.741	0.21
25_R	167_E	0.741	0.21
98_L	102_I	0.740	0.21
31_L	94_V	0.731	0.20
68_L	153_D	0.731	0.20
125_A	128_M	0.728	0.20
47_A	109_I	0.726	0.20
48_F	116_I	0.726	0.20
46_W	56_D	0.721	0.20
63_N	160_L	0.719	0.20
41_K	46_W	0.717	0.20
120_L	124_C	0.712	0.20
107_V	123_R	0.708	0.19
33_K	108_D	0.707	0.19
33_K	90_D	0.707	0.19
124_C	141_T	0.702	0.19
47_A	82_T	0.695	0.19
154_I	161_Y	0.680	0.19
49_D	140_V	0.679	0.18
90_D	139_G	0.671	0.18
108_D	139_G	0.671	0.18
26_G	138_L	0.669	0.18
76_I	140_V	0.662	0.18
62_I	172_A	0.658	0.18
37_V	166_W	0.656	0.18
113_N	158_E	0.655	0.18
120_L	173_N	0.650	0.18
122_E	173_N	0.648	0.18
46_W	117_I	0.646	0.17
50_A	145_G	0.645	0.17
124_C	152_T	0.634	0.17
70_T	94_V	0.633	0.17
125_A	134_Y	0.633	0.17
41_K	82_T	0.629	0.17
61_G	105_L	0.629	0.17
95_V	155_E	0.627	0.17
161_Y	171_K	0.626	0.17
110_A	160_L	0.624	0.17
154_I	160_L	0.620	0.17
58_V	113_N	0.617	0.17
64_Q	113_N	0.617	0.17
36_L	171_K	0.616	0.17
27_K	150_N	0.614	0.16
44_I	61_G	0.613	0.16
132_K	165_T	0.610	0.16
27_K	161_Y	0.609	0.16
29_I	101_P	0.609	0.16
68_L	146_L	0.604	0.16
28_R	33_K	0.603	0.16
118_N	121_I	0.602	0.16
88_E	161_Y	0.593	0.16
117_I	150_N	0.592	0.16
48_F	77_F	0.591	0.16
120_L	166_W	0.584	0.16
68_L	98_L	0.577	0.15
58_V	154_I	0.576	0.15
99_G	135_G	0.576	0.15
77_F	145_G	0.574	0.15
109_I	142_Y	0.574	0.15
127_D	131_L	0.572	0.15
26_G	34_P	0.571	0.15
88_E	91_V	0.570	0.15
104_V	114_N	0.568	0.15
137_Y	142_Y	0.563	0.15
32_F	63_N	0.563	0.15
51_V	55_S	0.563	0.15
77_F	150_N	0.560	0.15
128_M	143_W	0.560	0.15
56_D	140_V	0.559	0.15
80_F	121_I	0.558	0.15
25_R	78_K	0.555	0.15
103_L	131_L	0.552	0.15
154_I	162_N	0.549	0.15
106_P	172_A	0.544	0.15
30_T	71_I	0.544	0.15
29_I	106_P	0.541	0.14
140_V	157_K	0.538	0.14
73_K	101_P	0.537	0.14
21_L	26_G	0.530	0.14
95_V	145_G	0.528	0.14
46_W	145_G	0.527	0.14
38_V	172_A	0.526	0.14
133_S	174_K	0.524	0.14
40_G	107_V	0.522	0.14
51_V	91_V	0.520	0.14
134_Y	159_K	0.519	0.14
21_L	58_V	0.517	0.14
62_I	125_A	0.517	0.14
70_T	103_L	0.517	0.14
30_T	124_C	0.513	0.14
27_K	164_N	0.513	0.14
22_A	46_W	0.511	0.14
69_F	160_L	0.508	0.14
48_F	53_K	0.508	0.14
113_N	122_E	0.506	0.14
134_Y	141_T	0.501	0.13
58_V	174_K	0.501	0.13
88_E	109_I	0.500	0.13
87_Y	108_D	0.500	0.13
87_Y	90_D	0.500	0.13
75_S	122_E	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3rsbA	1	0.8547	99.9	0.62	Contact Map
2wawA	1	0.9274	99.9	0.661	Contact Map
3ngwA	2	0.8883	99.9	0.67	Contact Map
2weeA	1	0.9106	99.9	0.675	Contact Map
1vpaA	2	0.933	99.9	0.683	Contact Map
2e8bA	1	0.8827	99.9	0.684	Contact Map
1e5kA	1	0.8771	99.9	0.685	Contact Map
3d5nA	2	0.8492	99.8	0.686	Contact Map
1i52A	2	0.9218	99.8	0.691	Contact Map
1vgwA	2	0.8939	99.8	0.692	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.