Q7LY04 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LY04 - Uncharacterized protein

UniProt:	Q7LY04	Sequences: MKRIIILSPFRGLFRSLLYFLLGLIMALISAGYFSQLFSIVGINRDIAIIISITISFLSLFSSPFNLVLTEVKKEAIAIEEDVVFFFGFPIFIPRISRQNMNTLIAVNLGGALIPLGVSLFLMYELQAYIVYFIINIIVVIIVSKLFSRVIRGVGVIMHPIIPSIFSVISSYVLFYKLHILIPLSAYIGSVLGTLIGADLLNLRRIINEARPQVISIGGMGTFDGIFVSGIISVFISELLVII	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	243 (221)
Sequences:	171 (148)
Seq/√Len:	10.0

SULSO - Q7LY04

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
145_K	202_N	3.982	0.99
109_L	113_L	3.975	0.99
59_S	187_Y	3.674	0.98
202_N	205_R	3.638	0.98
141_I	201_L	3.265	0.95
144_S	158_M	3.114	0.94
62_S	68_V	3.097	0.94
196_I	200_L	2.976	0.92
148_S	156_V	2.910	0.91
65_F	109_L	2.753	0.89
199_D	224_D	2.705	0.88
119_S	187_Y	2.651	0.87
49_I	231_I	2.553	0.85
206_I	215_I	2.540	0.84
71_E	102_N	2.445	0.82
45_R	200_L	2.321	0.78
84_V	88_G	2.205	0.75
59_S	122_L	2.092	0.71
187_Y	227_F	2.063	0.69
59_S	202_N	2.040	0.69
44_N	183_P	2.002	0.67
10_F	158_M	1.957	0.65
119_S	122_L	1.908	0.63
140_V	194_T	1.876	0.62
107_V	112_A	1.851	0.61
81_E	93_I	1.826	0.60
32_G	212_P	1.790	0.58
67_L	196_I	1.780	0.57
62_S	190_S	1.772	0.57
199_D	230_G	1.753	0.56
72_V	103_T	1.721	0.55
112_A	202_N	1.690	0.53
118_V	202_N	1.655	0.52
164_S	228_V	1.642	0.51
67_L	124_Y	1.578	0.48
79_I	204_R	1.532	0.46
118_V	165_I	1.498	0.45
112_A	205_R	1.498	0.45
224_D	230_G	1.497	0.45
109_L	121_F	1.490	0.44
32_G	37_L	1.462	0.43
46_D	113_L	1.449	0.42
123_M	133_F	1.446	0.42
190_S	220_M	1.444	0.42
220_M	233_S	1.425	0.41
59_S	119_S	1.419	0.41
137_I	148_S	1.401	0.40
41_V	62_S	1.400	0.40
116_L	165_I	1.397	0.40
205_R	208_N	1.396	0.40
34_F	229_S	1.392	0.40
220_M	230_G	1.389	0.40
145_K	204_R	1.385	0.40
222_T	234_V	1.381	0.39
69_L	113_L	1.355	0.38
143_V	166_F	1.343	0.38
44_N	47_I	1.333	0.37
41_V	68_V	1.330	0.37
21_L	105_I	1.326	0.37
15_R	19_Y	1.301	0.36
187_Y	212_P	1.294	0.36
203_L	237_S	1.278	0.35
122_L	227_F	1.266	0.35
37_L	235_F	1.246	0.34
171_S	182_I	1.236	0.33
69_L	156_V	1.236	0.33
73_K	102_N	1.231	0.33
105_I	215_I	1.224	0.33
60_L	87_F	1.222	0.33
57_F	139_V	1.221	0.33
145_K	205_R	1.217	0.33
17_L	165_I	1.213	0.32
14_F	105_I	1.195	0.32
147_F	162_I	1.181	0.31
134_I	201_L	1.175	0.31
40_I	171_S	1.172	0.31
114_I	194_T	1.169	0.31
148_S	158_M	1.163	0.30
225_G	230_G	1.151	0.30
159_H	163_P	1.139	0.29
14_F	18_L	1.137	0.29
158_M	163_P	1.135	0.29
156_V	199_D	1.133	0.29
18_L	48_A	1.128	0.29
40_I	188_I	1.123	0.29
187_Y	191_V	1.123	0.29
91_I	112_A	1.117	0.29
74_K	103_T	1.115	0.29
41_V	45_R	1.099	0.28
134_I	138_I	1.088	0.28
38_F	187_Y	1.077	0.27
25_I	60_L	1.075	0.27
40_I	236_I	1.074	0.27
12_G	29_I	1.068	0.27
217_I	228_V	1.067	0.27
91_I	95_R	1.063	0.27
38_F	227_F	1.060	0.27
28_L	174_L	1.053	0.26
199_D	220_M	1.047	0.26
109_L	134_I	1.040	0.26
216_S	224_D	1.032	0.26
122_L	187_Y	1.022	0.25
116_L	189_G	1.021	0.25
113_L	173_V	1.010	0.25
24_L	152_R	1.009	0.25
216_S	230_G	1.005	0.25
108_N	155_G	1.004	0.25
212_P	227_F	1.002	0.25
67_L	125_E	0.989	0.24
19_Y	131_V	0.987	0.24
154_V	166_F	0.987	0.24
17_L	26_M	0.983	0.24
16_S	21_L	0.981	0.24
105_I	133_F	0.973	0.24
21_L	139_V	0.968	0.23
156_V	224_D	0.962	0.23
167_S	233_S	0.957	0.23
196_I	226_I	0.957	0.23
220_M	224_D	0.939	0.22
87_F	185_S	0.939	0.22
138_I	188_I	0.937	0.22
40_I	68_V	0.936	0.22
44_N	48_A	0.935	0.22
171_S	191_V	0.932	0.22
138_I	233_S	0.931	0.22
63_S	199_D	0.923	0.22
148_S	175_F	0.923	0.22
79_I	113_L	0.916	0.22
18_L	147_F	0.903	0.21
180_I	188_I	0.898	0.21
20_F	131_V	0.897	0.21
107_V	139_V	0.897	0.21
26_M	124_Y	0.895	0.21
156_V	190_S	0.891	0.21
65_F	121_F	0.890	0.21
107_V	113_L	0.889	0.21
18_L	228_V	0.887	0.21
71_E	189_G	0.885	0.21
112_A	145_K	0.879	0.21
198_A	224_D	0.877	0.21
164_S	225_G	0.873	0.20
139_V	158_M	0.868	0.20
37_L	62_S	0.865	0.20
46_D	69_L	0.859	0.20
76_A	204_R	0.856	0.20
74_K	184_L	0.854	0.20
104_L	165_I	0.852	0.20
75_E	226_I	0.850	0.20
37_L	40_I	0.846	0.20
11_R	143_V	0.840	0.19
198_A	217_I	0.840	0.19
148_S	163_P	0.834	0.19
27_A	56_S	0.832	0.19
216_S	225_G	0.827	0.19
46_D	237_S	0.826	0.19
156_V	200_L	0.825	0.19
217_I	220_M	0.825	0.19
22_L	33_Y	0.824	0.19
61_F	142_I	0.823	0.19
116_L	148_S	0.817	0.19
151_I	157_I	0.813	0.19
154_V	157_I	0.810	0.19
63_S	191_V	0.808	0.19
18_L	202_N	0.807	0.19
13_L	135_I	0.806	0.19
10_F	231_I	0.804	0.18
212_P	215_I	0.802	0.18
106_A	161_I	0.802	0.18
188_I	193_G	0.800	0.18
164_S	199_D	0.800	0.18
22_L	166_F	0.799	0.18
48_A	132_Y	0.798	0.18
196_I	230_G	0.793	0.18
117_G	167_S	0.791	0.18
89_F	126_L	0.791	0.18
23_G	58_L	0.787	0.18
139_V	172_Y	0.785	0.18
33_Y	191_V	0.785	0.18
23_G	222_T	0.784	0.18
134_I	208_N	0.783	0.18
22_L	183_P	0.781	0.18
37_L	68_V	0.780	0.18
56_S	122_L	0.779	0.18
140_V	143_V	0.778	0.18
102_N	142_I	0.775	0.18
21_L	120_L	0.771	0.18
38_F	191_V	0.771	0.18
93_I	170_S	0.760	0.17
51_I	163_P	0.760	0.17
49_I	131_V	0.759	0.17
216_S	236_I	0.756	0.17
66_N	216_S	0.753	0.17
74_K	210_A	0.751	0.17
123_M	231_I	0.749	0.17
93_I	142_I	0.748	0.17
160_P	191_V	0.741	0.17
187_Y	194_T	0.737	0.17
44_N	161_I	0.737	0.17
167_S	232_I	0.735	0.17
18_L	200_L	0.733	0.17
109_L	139_V	0.733	0.17
151_I	206_I	0.729	0.16
107_V	216_S	0.729	0.16
25_I	82_D	0.727	0.16
31_A	56_S	0.723	0.16
150_V	209_E	0.721	0.16
43_I	69_L	0.720	0.16
8_S	188_I	0.718	0.16
139_V	170_S	0.715	0.16
220_M	236_I	0.715	0.16
67_L	232_I	0.715	0.16
112_A	227_F	0.715	0.16
187_Y	236_I	0.712	0.16
119_S	227_F	0.703	0.16
171_S	211_R	0.700	0.16
34_F	37_L	0.699	0.16
21_L	121_F	0.698	0.16
117_G	135_I	0.698	0.16
27_A	113_L	0.697	0.16
150_V	191_V	0.697	0.16
203_L	217_I	0.694	0.16
187_Y	202_N	0.691	0.16
186_A	190_S	0.690	0.16
77_I	104_L	0.688	0.15
164_S	224_D	0.688	0.15
148_S	202_N	0.686	0.15
150_V	211_R	0.686	0.15
10_F	144_S	0.685	0.15
96_I	145_K	0.685	0.15
63_S	198_A	0.684	0.15
216_S	220_M	0.679	0.15
199_D	225_G	0.678	0.15
209_E	212_P	0.676	0.15
19_Y	22_L	0.675	0.15
50_I	139_V	0.672	0.15
36_Q	226_I	0.671	0.15
119_S	194_T	0.670	0.15
218_G	221_G	0.669	0.15
140_V	170_S	0.667	0.15
61_F	120_L	0.660	0.15
133_F	137_I	0.660	0.15
60_L	212_P	0.659	0.15
69_L	120_L	0.655	0.15
105_I	142_I	0.654	0.15
228_V	232_I	0.651	0.15
15_R	104_L	0.644	0.14
87_F	173_V	0.643	0.14
96_I	173_V	0.642	0.14
163_P	236_I	0.641	0.14
227_F	234_V	0.639	0.14
75_E	207_I	0.635	0.14
21_L	137_I	0.633	0.14
120_L	208_N	0.632	0.14
171_S	175_F	0.632	0.14
135_I	138_I	0.631	0.14
103_T	223_F	0.631	0.14
17_L	28_L	0.629	0.14
121_F	172_Y	0.629	0.14
23_G	27_A	0.620	0.14
26_M	123_M	0.619	0.14
27_A	185_S	0.618	0.14
10_F	137_I	0.617	0.14
167_S	191_V	0.616	0.14
13_L	162_I	0.616	0.14
164_S	187_Y	0.616	0.14
26_M	231_I	0.615	0.14
24_L	114_I	0.614	0.14
32_G	60_L	0.613	0.14
84_V	90_P	0.608	0.14
222_T	236_I	0.605	0.14
157_I	202_N	0.604	0.14
164_S	230_G	0.603	0.14
68_V	190_S	0.602	0.14
26_M	117_G	0.601	0.14
164_S	167_S	0.601	0.14
35_S	49_I	0.598	0.13
131_V	232_I	0.597	0.13
67_L	148_S	0.597	0.13
159_H	231_I	0.596	0.13
199_D	217_I	0.594	0.13
131_V	168_V	0.593	0.13
123_M	126_L	0.591	0.13
123_M	160_P	0.589	0.13
33_Y	93_I	0.588	0.13
15_R	21_L	0.586	0.13
191_V	211_R	0.583	0.13
190_S	233_S	0.582	0.13
61_F	192_L	0.581	0.13
79_I	211_R	0.580	0.13
65_F	102_N	0.580	0.13
42_G	194_T	0.579	0.13
58_L	122_L	0.574	0.13
156_V	195_L	0.570	0.13
86_F	157_I	0.566	0.13
144_S	194_T	0.563	0.13
66_N	224_D	0.560	0.13
59_S	227_F	0.560	0.13
89_F	92_F	0.557	0.13
126_L	144_S	0.553	0.13
36_Q	169_I	0.551	0.12
120_L	192_L	0.548	0.12
36_Q	176_Y	0.545	0.12
148_S	182_I	0.543	0.12
67_L	228_V	0.542	0.12
32_G	227_F	0.541	0.12
33_Y	208_N	0.541	0.12
144_S	233_S	0.540	0.12
114_I	211_R	0.539	0.12
79_I	208_N	0.533	0.12
202_N	224_D	0.531	0.12
12_G	180_I	0.530	0.12
91_I	163_P	0.530	0.12
164_S	189_G	0.530	0.12
14_F	122_L	0.529	0.12
88_G	112_A	0.529	0.12
144_S	166_F	0.528	0.12
19_Y	173_V	0.526	0.12
18_L	50_I	0.525	0.12
66_N	217_I	0.525	0.12
95_R	135_I	0.523	0.12
66_N	199_D	0.523	0.12
63_S	224_D	0.519	0.12
51_I	173_V	0.517	0.12
32_G	231_I	0.517	0.12
56_S	68_V	0.513	0.12
19_Y	76_A	0.510	0.12
18_L	30_S	0.510	0.12
44_N	142_I	0.509	0.12
105_I	144_S	0.508	0.12
96_I	175_F	0.508	0.12
163_P	166_F	0.503	0.12
156_V	214_V	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j5pB	3	0.2922	2.6	0.974	Contact Map
3ffvA	1	0.2469	2.4	0.975	Contact Map
1rq8A	1	0.1975	1.9	0.976	Contact Map
3ar4A	1	0.3086	1.7	0.977	Contact Map
3ixzA	1	0.3374	1.6	0.977	Contact Map
2kncB	1	0.1564	1.4	0.978	Contact Map
4j7cI	2	0.358	1.4	0.978	Contact Map
4czbA	2	0.8848	1.3	0.978	Contact Map
1ckkB	1	0.0412	1.1	0.979	Contact Map
4ezcA	3	0.3498	1	0.98	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.