Q7LXX5 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXX5 - Third ORF in transposon ISC1229

UniProt:	Q7LXX5	Sequences: MKEVRKMIEGNVPQDHVLLTIPGIGKLAAGIIIGIVGDIRRFPRPESFVAYCGLDPVVERSGRIEVRKGISKRGNKYLRSLFYFLAETQYSRNPTLLKFYEAHKDKLKGRKLYTALARKLPKYRWSVWYNNKPYEVK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	137 (130)
Sequences:	4120 (2916)
Seq/√Len:	255.8

SULSO - Q7LXX5 Q97Z62 Q97Y06 Q97UF7 Q97YE1 Q97UQ6 Q97ZN4 Q97WZ5 Q97X29 Q97X07 Q97Y59 Q97XV5 Q97X12 Q97X26 Q97WC0 Q97XK2 Q97VS0 Q97WY7 Q97VB2 Q97TX3 Q97XR9 Q97XM7 Q97XL7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_V	133_P	2.505	1.00
20_T	133_P	2.438	1.00
103_H	106_K	2.362	1.00
48_F	121_P	2.312	1.00
13_P	131_N	2.246	1.00
32_I	124_R	2.243	1.00
52_C	78_L	2.075	1.00
36_V	48_F	2.045	1.00
43_P	47_S	2.043	1.00
118_R	122_K	2.028	1.00
108_K	111_K	1.961	1.00
60_R	65_E	1.948	1.00
44_R	47_S	1.829	1.00
52_C	121_P	1.821	1.00
31_I	81_L	1.799	1.00
17_V	127_V	1.780	1.00
97_L	101_E	1.773	1.00
24_I	29_A	1.767	1.00
54_L	117_A	1.754	1.00
19_L	26_K	1.749	1.00
126_S	130_N	1.739	1.00
132_K	135_E	1.724	1.00
70_I	114_T	1.721	1.00
99_F	119_K	1.721	1.00
49_V	55_D	1.708	1.00
96_L	116_L	1.623	1.00
28_A	81_L	1.605	1.00
107_L	111_K	1.587	1.00
102_A	106_K	1.585	1.00
14_Q	131_N	1.585	1.00
84_F	87_E	1.572	1.00
21_I	124_R	1.571	1.00
125_W	129_Y	1.567	1.00
28_A	85_L	1.546	1.00
18_L	124_R	1.518	1.00
100_Y	116_L	1.507	1.00
42_F	51_Y	1.485	1.00
96_L	123_Y	1.447	1.00
17_V	20_T	1.439	1.00
123_Y	127_V	1.406	1.00
127_V	133_P	1.395	1.00
86_A	116_L	1.391	1.00
21_I	127_V	1.369	1.00
14_Q	128_W	1.365	1.00
49_V	118_R	1.362	1.00
7_M	10_G	1.355	1.00
83_Y	117_A	1.352	1.00
39_I	128_W	1.278	1.00
35_I	75_N	1.264	1.00
21_I	120_L	1.236	1.00
9_E	26_K	1.231	1.00
35_I	77_Y	1.200	1.00
13_P	17_V	1.197	1.00
94_P	98_K	1.196	1.00
36_V	39_I	1.174	1.00
103_H	112_L	1.157	1.00
100_Y	112_L	1.151	1.00
99_F	103_H	1.144	1.00
101_E	105_D	1.141	1.00
86_A	117_A	1.127	1.00
83_Y	87_E	1.097	1.00
12_V	16_H	1.097	1.00
99_F	116_L	1.076	1.00
61_S	65_E	1.074	1.00
87_E	110_R	1.045	1.00
90_Y	100_Y	1.035	1.00
82_F	121_P	1.030	1.00
104_K	109_G	1.028	1.00
24_I	28_A	1.019	1.00
99_F	102_A	1.015	1.00
94_P	97_L	1.011	1.00
80_S	84_F	0.999	1.00
83_Y	114_T	0.966	1.00
24_I	124_R	0.959	1.00
85_L	120_L	0.949	1.00
70_I	79_R	0.931	1.00
108_K	112_L	0.930	1.00
83_Y	110_R	0.925	1.00
12_V	33_I	0.911	1.00
87_E	90_Y	0.911	1.00
58_V	65_E	0.906	1.00
32_I	78_L	0.898	1.00
57_V	71_S	0.894	1.00
15_D	19_L	0.891	1.00
95_T	134_Y	0.887	1.00
19_L	29_A	0.886	1.00
98_K	101_E	0.882	1.00
98_K	102_A	0.874	1.00
14_Q	17_V	0.869	1.00
51_Y	75_N	0.868	1.00
96_L	120_L	0.846	0.99
102_A	105_D	0.844	0.99
110_R	113_Y	0.842	0.99
110_R	114_T	0.838	0.99
124_R	127_V	0.834	0.99
103_H	107_L	0.828	0.99
70_I	115_A	0.825	0.99
88_T	92_R	0.819	0.99
126_S	129_Y	0.818	0.99
114_T	117_A	0.812	0.99
15_D	30_G	0.798	0.99
46_E	118_R	0.789	0.99
55_D	71_S	0.777	0.99
100_Y	104_K	0.776	0.99
24_I	120_L	0.774	0.99
18_L	128_W	0.774	0.99
84_F	110_R	0.774	0.99
89_Q	96_L	0.773	0.99
59_E	64_I	0.773	0.99
93_N	97_L	0.773	0.99
127_V	132_K	0.767	0.99
17_V	131_N	0.766	0.99
103_H	115_A	0.756	0.99
55_D	58_V	0.748	0.99
15_D	29_A	0.741	0.99
87_E	113_Y	0.740	0.98
44_R	125_W	0.735	0.98
18_L	29_A	0.735	0.98
69_G	111_K	0.732	0.98
42_F	48_F	0.726	0.98
27_L	31_I	0.720	0.98
55_D	79_R	0.718	0.98
85_L	89_Q	0.717	0.98
86_A	113_Y	0.709	0.98
55_D	72_K	0.708	0.98
72_K	79_R	0.707	0.98
24_I	32_I	0.704	0.98
123_Y	126_S	0.699	0.98
74_G	79_R	0.699	0.98
54_L	118_R	0.689	0.98
90_Y	104_K	0.688	0.98
104_K	112_L	0.680	0.97
58_V	67_R	0.679	0.97
81_L	85_L	0.678	0.97
13_P	16_H	0.677	0.97
47_S	50_A	0.676	0.97
85_L	117_A	0.672	0.97
45_P	122_K	0.670	0.97
21_I	24_I	0.667	0.97
82_F	124_R	0.662	0.97
87_E	117_A	0.661	0.97
101_E	104_K	0.657	0.97
15_D	33_I	0.650	0.97
87_E	91_S	0.649	0.97
11_N	14_Q	0.648	0.97
16_H	133_P	0.640	0.96
21_I	123_Y	0.636	0.96
104_K	107_L	0.630	0.96
12_V	15_D	0.623	0.96
50_A	55_D	0.622	0.96
31_I	35_I	0.621	0.96
64_I	68_K	0.621	0.96
55_D	73_R	0.618	0.95
19_L	25_G	0.615	0.95
45_P	125_W	0.613	0.95
35_I	52_C	0.609	0.95
119_K	122_K	0.608	0.95
39_I	125_W	0.607	0.95
55_D	75_N	0.601	0.95
70_I	74_G	0.600	0.95
86_A	120_L	0.594	0.94
6_K	10_G	0.594	0.94
77_Y	81_L	0.594	0.94
71_S	74_G	0.593	0.94
14_Q	33_I	0.584	0.94
80_S	83_Y	0.582	0.94
49_V	54_L	0.572	0.93
93_N	98_K	0.565	0.93
26_K	30_G	0.559	0.92
8_I	30_G	0.555	0.92
122_K	126_S	0.554	0.92
52_C	81_L	0.554	0.92
49_V	122_K	0.552	0.92
45_P	49_V	0.551	0.92
15_D	26_K	0.549	0.92
32_I	36_V	0.547	0.92
37_G	41_R	0.547	0.92
90_Y	116_L	0.546	0.92
89_Q	93_N	0.543	0.91
58_V	68_K	0.540	0.91
30_G	77_Y	0.537	0.91
99_F	115_A	0.536	0.91
31_I	77_Y	0.532	0.90
28_A	82_F	0.527	0.90
59_E	68_K	0.526	0.90
112_L	116_L	0.517	0.89
11_N	16_H	0.516	0.89
49_V	121_P	0.515	0.89
60_R	64_I	0.513	0.89
80_S	126_S	0.511	0.89
79_R	114_T	0.510	0.89
93_N	123_Y	0.508	0.88
11_N	15_D	0.506	0.88
28_A	32_I	0.502	0.88
35_I	84_F	0.500	0.88

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2a1jB	2	0.5328	88.5	0.884	Contact Map
3c65A	1	0.0438	88.3	0.885	Contact Map
1pu6A	1	0.7226	87.7	0.886	Contact Map
3fhfA	1	0.7299	86.7	0.888	Contact Map
2lyhA	1	0.4964	86.6	0.888	Contact Map
4pj0U	1	0.5839	86.2	0.889	Contact Map
2bgwA	2	0.5182	85.9	0.889	Contact Map
3n0uA	1	0.7445	85.6	0.889	Contact Map
4ofaA	1	0.4526	85.4	0.89	Contact Map
1keaA	2	0.7956	83	0.893	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.