Q7LXW3 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXW3 - Uncharacterized protein

UniProt:	Q7LXW3	Sequences: MKIAPPQVWRNKRFMYKLTASRCERCGHISFPYSSYCTKCGSKNVKKIEISGKGVLESYTVSYQSRDGHEKGLPSVIGLVRLDEGVEIVAPIVDADLDKLKEGVKVEATLRRVYTDSYNGLIQYGIKFRVAEG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	133 (111)
Sequences:	2357 (1477)
Seq/√Len:	140.2

HALSA - Q9HRI9
SULSO - Q7LXW3 Q97UW9 Q97VJ8 Q97UA6 Q97WQ4 Q97WQ5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_K	49_E	3.014	1.00
26_C	40_C	2.677	1.00
25_R	44_N	2.648	1.00
56_L	106_V	2.613	1.00
22_R	48_I	2.609	1.00
24_E	46_K	2.599	1.00
26_C	37_C	2.439	1.00
37_C	40_C	2.386	1.00
83_D	105_K	2.362	1.00
6_P	10_R	2.203	1.00
54_G	106_V	2.117	1.00
23_C	26_C	2.093	1.00
53_K	83_D	2.079	1.00
81_R	87_E	2.051	1.00
23_C	37_C	2.002	1.00
11_N	19_T	1.980	1.00
23_C	40_C	1.970	1.00
30_S	38_T	1.901	1.00
56_L	78_G	1.835	1.00
20_A	50_I	1.793	1.00
28_H	39_K	1.744	1.00
24_E	44_N	1.742	1.00
56_L	100_L	1.742	1.00
16_Y	112_R	1.737	1.00
53_K	107_E	1.715	1.00
53_K	105_K	1.665	1.00
96_D	99_K	1.593	1.00
21_S	30_S	1.579	1.00
52_G	84_E	1.577	1.00
55_V	105_K	1.551	1.00
7_Q	47_K	1.525	1.00
19_T	49_E	1.496	1.00
55_V	81_R	1.470	1.00
29_I	48_I	1.443	1.00
21_S	45_V	1.438	1.00
80_V	90_A	1.373	1.00
51_S	83_D	1.369	1.00
30_S	45_V	1.366	1.00
22_R	29_I	1.325	1.00
57_E	81_R	1.313	1.00
78_G	92_I	1.296	1.00
59_Y	102_E	1.176	1.00
54_G	80_V	1.166	0.99
16_Y	110_L	1.159	0.99
51_S	84_E	1.158	0.99
58_S	79_L	1.118	0.99
101_K	104_V	1.118	0.99
10_R	15_M	1.109	0.99
95_A	104_V	1.042	0.99
12_K	110_L	1.026	0.99
56_L	104_V	1.025	0.99
20_A	86_V	1.021	0.99
42_S	45_V	1.011	0.99
55_V	103_G	1.004	0.98
59_Y	100_L	0.984	0.98
29_I	50_I	0.978	0.98
112_R	115_T	0.973	0.98
61_V	76_V	0.972	0.98
57_E	87_E	0.943	0.98
36_Y	43_K	0.940	0.98
25_R	42_S	0.935	0.98
22_R	27_G	0.933	0.98
78_G	90_A	0.929	0.97
92_I	100_L	0.892	0.97
79_L	89_V	0.874	0.96
22_R	46_K	0.863	0.96
61_V	97_L	0.858	0.96
79_L	87_E	0.839	0.95
60_T	77_I	0.839	0.95
95_A	99_K	0.832	0.95
7_Q	11_N	0.830	0.95
5_P	9_W	0.828	0.95
59_Y	92_I	0.825	0.95
11_N	17_K	0.820	0.95
30_S	34_S	0.812	0.95
63_Y	74_P	0.793	0.94
59_Y	104_V	0.788	0.94
8_V	12_K	0.788	0.94
62_S	75_S	0.771	0.93
11_N	15_M	0.770	0.93
12_K	108_A	0.765	0.93
7_Q	10_R	0.764	0.93
56_L	102_E	0.755	0.92
75_S	91_P	0.754	0.92
36_Y	41_G	0.752	0.92
59_Y	76_V	0.747	0.92
97_L	100_L	0.745	0.92
76_V	100_L	0.740	0.91
82_L	86_V	0.730	0.91
21_S	31_F	0.723	0.90
33_Y	47_K	0.720	0.90
20_A	29_I	0.713	0.90
94_D	109_T	0.703	0.89
99_K	104_V	0.700	0.89
54_G	88_I	0.697	0.89
18_L	31_F	0.694	0.88
94_D	107_E	0.690	0.88
93_V	109_T	0.690	0.88
94_D	111_R	0.676	0.87
36_Y	45_V	0.674	0.87
15_M	19_T	0.669	0.87
50_I	82_L	0.668	0.86
76_V	92_I	0.668	0.86
66_R	73_L	0.667	0.86
65_S	74_P	0.662	0.86
62_S	69_H	0.658	0.86
100_L	106_V	0.653	0.85
8_V	11_N	0.650	0.85
18_L	50_I	0.640	0.84
9_W	74_P	0.630	0.83
21_S	47_K	0.629	0.83
8_V	108_A	0.626	0.83
90_A	93_V	0.622	0.82
92_I	95_A	0.620	0.82
81_R	85_G	0.619	0.82
20_A	48_I	0.616	0.82
12_K	88_I	0.614	0.82
70_E	96_D	0.598	0.80
80_V	106_V	0.596	0.80
57_E	79_L	0.592	0.79
57_E	102_E	0.588	0.79
64_Q	73_L	0.587	0.79
54_G	83_D	0.585	0.78
34_S	38_T	0.579	0.78
31_F	88_I	0.578	0.78
37_C	42_S	0.577	0.77
34_S	47_K	0.574	0.77
113_V	116_D	0.572	0.77
6_P	111_R	0.561	0.75
50_I	86_V	0.558	0.75
20_A	82_L	0.557	0.75
54_G	90_A	0.556	0.75
10_R	14_F	0.553	0.74
79_L	90_A	0.552	0.74
51_S	108_A	0.551	0.74
45_V	79_L	0.550	0.74
20_A	31_F	0.550	0.74
16_Y	111_R	0.548	0.74
57_E	69_H	0.546	0.73
65_S	73_L	0.545	0.73
15_M	49_E	0.544	0.73
66_R	69_H	0.535	0.72
77_I	109_T	0.535	0.72
52_G	107_E	0.530	0.71
5_P	31_F	0.528	0.71
76_V	96_D	0.527	0.71
11_N	58_S	0.524	0.70
64_Q	79_L	0.523	0.70
27_G	101_K	0.519	0.70
14_F	116_D	0.518	0.70
65_S	75_S	0.517	0.69
76_V	97_L	0.517	0.69
53_K	84_E	0.516	0.69
57_E	104_V	0.516	0.69
63_Y	98_D	0.513	0.69
56_L	103_G	0.513	0.69
23_C	44_N	0.513	0.69
101_K	105_K	0.510	0.68
19_T	47_K	0.510	0.68
23_C	42_S	0.509	0.68
43_K	60_T	0.506	0.68
76_V	95_A	0.505	0.68
9_W	91_P	0.502	0.67
25_R	101_K	0.502	0.67
52_G	108_A	0.502	0.67
81_R	86_V	0.500	0.67

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3irbA	3	0.8647	100	0.275	Contact Map
2lcqA	1	0.3759	85.3	0.888	Contact Map
2kdxA	1	0.4662	75.4	0.899	Contact Map
5aunA	1	0.4662	73.3	0.901	Contact Map
3pwfA	4	0.3684	63.7	0.907	Contact Map
4aybP	1	0.2857	59.4	0.91	Contact Map
4d02A	2	0.015	57.4	0.911	Contact Map
1lkoA	3	0.3985	56	0.911	Contact Map
1yuzA	2	0.3759	54.9	0.912	Contact Map
2gmgA	1	0.4135	50.3	0.914	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.