Q7LXU8 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXU8 - Ribosomal protein L11 methyltransferase, putative

UniProt:	Q7LXU8	Sequences: MSYVPHVPYVPTPEKVVRRMLEIAKASQDDIVYDLGCGDGRIIITAVKDFNVKKAIGVEINDERIREALANIEKNGVTGRASIVKGNFFEVDISEATVVTMFLLTNVNEMLKPKLEKELKPGTRVVSHEFEIRGWNPKEVVKVEDGNMNHTVYLYVIGEHK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	161 (146)
Sequences:	624 (469)
Seq/√Len:	38.8

SULSO - Q7LXU8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
114_K	118_E	6.161	1.00
37_C	68_A	4.491	1.00
59_E	64_R	3.241	1.00
72_I	83_I	3.139	1.00
58_V	91_V	3.093	1.00
26_A	98_V	3.079	1.00
8_P	107_V	2.787	1.00
30_D	97_T	2.637	1.00
72_I	77_V	2.573	1.00
59_E	65_I	2.432	1.00
35_L	93_I	2.352	1.00
37_C	59_E	2.346	1.00
7_V	107_V	2.162	0.99
99_V	115_L	2.114	0.99
23_I	154_L	2.029	0.99
43_I	81_A	1.977	0.99
32_V	52_V	1.908	0.98
20_M	100_T	1.881	0.98
19_R	22_E	1.875	0.98
33_Y	96_A	1.852	0.98
43_I	83_I	1.767	0.97
33_Y	56_I	1.767	0.97
24_A	98_V	1.757	0.97
112_K	132_I	1.694	0.96
65_I	83_I	1.638	0.96
137_P	140_V	1.595	0.95
26_A	52_V	1.588	0.95
46_A	55_A	1.578	0.95
99_V	119_L	1.510	0.93
31_I	97_T	1.478	0.92
7_V	103_L	1.438	0.91
18_R	49_D	1.348	0.88
48_K	75_N	1.325	0.88
87_N	90_E	1.312	0.87
52_V	55_A	1.308	0.87
59_E	68_A	1.300	0.87
11_P	130_F	1.290	0.86
83_I	88_F	1.287	0.86
102_F	129_E	1.286	0.86
21_L	46_A	1.274	0.85
37_C	43_I	1.241	0.84
45_T	49_D	1.239	0.84
115_L	119_L	1.239	0.84
30_D	124_R	1.227	0.83
70_A	74_K	1.194	0.81
133_R	155_Y	1.189	0.81
58_V	93_I	1.189	0.81
44_I	77_V	1.188	0.81
14_E	45_T	1.181	0.81
131_E	155_Y	1.175	0.80
71_N	75_N	1.164	0.80
20_M	128_H	1.162	0.80
8_P	64_R	1.153	0.79
22_E	49_D	1.149	0.79
119_L	125_V	1.141	0.78
31_I	56_I	1.124	0.77
89_F	111_L	1.122	0.77
61_N	64_R	1.111	0.76
37_C	65_I	1.110	0.76
47_V	55_A	1.103	0.76
112_K	134_G	1.101	0.76
42_I	100_T	1.084	0.75
38_G	57_G	1.078	0.74
125_V	157_I	1.054	0.73
89_F	110_M	1.054	0.73
93_I	114_K	1.052	0.72
32_V	100_T	1.046	0.72
103_L	107_V	1.039	0.71
108_N	130_F	1.039	0.71
46_A	124_R	1.038	0.71
56_I	84_V	1.029	0.71
33_Y	95_E	1.004	0.69
102_F	155_Y	0.977	0.67
47_V	51_N	0.973	0.66
56_I	96_A	0.972	0.66
129_E	150_H	0.969	0.66
54_K	95_E	0.950	0.64
22_E	25_K	0.949	0.64
119_L	123_T	0.943	0.64
44_I	76_G	0.920	0.62
42_I	87_N	0.911	0.61
23_I	58_V	0.909	0.61
40_G	43_I	0.905	0.61
16_V	128_H	0.905	0.61
59_E	83_I	0.898	0.60
64_R	67_E	0.895	0.60
66_R	70_A	0.887	0.59
17_V	42_I	0.886	0.59
43_I	55_A	0.884	0.59
116_E	132_I	0.871	0.58
17_V	39_D	0.860	0.57
96_A	119_L	0.859	0.57
49_D	76_G	0.855	0.56
13_P	150_H	0.853	0.56
56_I	95_E	0.848	0.56
142_K	151_T	0.846	0.55
10_V	104_L	0.845	0.55
145_D	150_H	0.844	0.55
17_V	43_I	0.825	0.54
19_R	141_V	0.813	0.52
18_R	22_E	0.804	0.52
100_T	128_H	0.798	0.51
116_E	157_I	0.797	0.51
21_L	45_T	0.793	0.51
36_G	40_G	0.791	0.50
14_E	18_R	0.789	0.50
103_L	111_L	0.783	0.50
106_N	110_M	0.783	0.50
62_D	85_K	0.777	0.49
58_V	88_F	0.771	0.49
18_R	45_T	0.768	0.48
15_K	140_V	0.765	0.48
37_C	83_I	0.763	0.48
21_L	124_R	0.762	0.48
12_T	20_M	0.757	0.47
73_E	78_T	0.757	0.47
17_V	41_R	0.753	0.47
102_F	107_V	0.753	0.47
18_R	145_D	0.752	0.47
144_E	150_H	0.749	0.47
112_K	155_Y	0.747	0.47
89_F	118_E	0.730	0.45
32_V	106_N	0.729	0.45
25_K	139_E	0.725	0.45
86_G	93_I	0.721	0.44
138_K	156_V	0.718	0.44
59_E	67_E	0.716	0.44
39_D	101_M	0.711	0.43
46_A	51_N	0.708	0.43
138_K	155_Y	0.696	0.42
24_A	124_R	0.691	0.42
72_I	76_G	0.690	0.41
86_G	91_V	0.689	0.41
63_E	66_R	0.688	0.41
64_R	87_N	0.676	0.40
55_A	80_R	0.660	0.39
44_I	71_N	0.657	0.39
88_F	111_L	0.649	0.38
37_C	40_G	0.647	0.38
6_H	62_D	0.647	0.38
96_A	108_N	0.646	0.38
99_V	123_T	0.640	0.37
29_D	97_T	0.637	0.37
34_D	92_D	0.631	0.36
58_V	85_K	0.628	0.36
89_F	107_V	0.627	0.36
33_Y	92_D	0.620	0.35
12_T	103_L	0.619	0.35
93_I	130_F	0.619	0.35
115_L	135_W	0.617	0.35
7_V	127_S	0.616	0.35
25_K	80_R	0.616	0.35
79_G	126_V	0.615	0.35
51_N	55_A	0.614	0.35
27_S	30_D	0.610	0.35
20_M	152_V	0.605	0.34
129_E	145_D	0.605	0.34
82_S	139_E	0.605	0.34
23_I	115_L	0.601	0.34
65_I	72_I	0.599	0.34
122_G	127_S	0.599	0.34
55_A	126_V	0.597	0.34
34_D	39_D	0.597	0.34
37_C	64_R	0.596	0.34
20_M	126_V	0.593	0.33
10_V	101_M	0.591	0.33
55_A	61_N	0.589	0.33
124_R	135_W	0.587	0.33
127_S	130_F	0.586	0.33
43_I	47_V	0.584	0.33
31_I	96_A	0.583	0.32
125_V	135_W	0.582	0.32
41_R	115_L	0.579	0.32
32_V	42_I	0.577	0.32
35_L	58_V	0.577	0.32
39_D	55_A	0.575	0.32
16_V	129_E	0.575	0.32
17_V	32_V	0.571	0.32
47_V	71_N	0.570	0.31
17_V	45_T	0.569	0.31
33_Y	97_T	0.566	0.31
13_P	128_H	0.563	0.31
106_N	109_E	0.562	0.31
10_V	39_D	0.560	0.31
7_V	61_N	0.560	0.31
132_I	155_Y	0.554	0.30
32_V	98_V	0.554	0.30
104_L	129_E	0.548	0.30
89_F	108_N	0.548	0.30
61_N	107_V	0.547	0.30
35_L	132_I	0.547	0.30
116_E	125_V	0.547	0.30
31_I	54_K	0.546	0.30
117_K	157_I	0.546	0.30
34_D	41_R	0.546	0.30
109_E	138_K	0.545	0.30
20_M	24_A	0.544	0.29
54_K	84_V	0.543	0.29
6_H	104_L	0.540	0.29
114_K	117_K	0.540	0.29
107_V	119_L	0.539	0.29
54_K	88_F	0.536	0.29
13_P	129_E	0.534	0.29
109_E	155_Y	0.532	0.29
25_K	76_G	0.531	0.29
56_I	91_V	0.528	0.28
39_D	115_L	0.524	0.28
117_K	136_N	0.523	0.28
118_E	123_T	0.521	0.28
46_A	126_V	0.513	0.27
77_V	81_A	0.513	0.27
19_R	152_V	0.511	0.27
65_I	68_A	0.509	0.27
62_D	99_V	0.508	0.27
68_A	83_I	0.508	0.27
7_V	129_E	0.505	0.27
19_R	131_E	0.505	0.27
23_I	126_V	0.504	0.27
39_D	104_L	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
5bxyA	1	0.9317	99.9	0.569	Contact Map
3uwpA	1	1	99.6	0.667	Contact Map
1u2zA	1	1	99.6	0.675	Contact Map
1ws6A	1	0.9193	99.5	0.692	Contact Map
3tm4A	1	0.9814	99.5	0.696	Contact Map
3tmaA	2	0.9627	99.5	0.696	Contact Map
3hemA	2	0.9814	99.5	0.697	Contact Map
2o57A	2	0.9689	99.5	0.697	Contact Map
2iftA	1	0.9193	99.5	0.699	Contact Map
2fpoA	1	0.9565	99.5	0.699	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.