Q7LXU5 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXU5 - ATP synthase subunit K (AtpK)

UniProt:	Q7LXU5	Sequences: MKRASLILAFLIPVLVSSVIAAAQAPSDTAQGFAGINIGAGLAVGLAAIGAGIAVGMAAAAGVGVLTERRDMFGTVLIFVAIGEGIAVYGILFAVLMLFGKF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	102 (80)
Sequences:	470 (250)
Seq/√Len:	28.0

HALSA - Q9HND9
SULSO - Q7LXU5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
47_A	90_G	5.358	1.00
62_G	80_V	3.092	1.00
42_L	46_L	2.961	1.00
41_G	45_G	2.900	1.00
45_G	52_G	2.481	0.99
57_M	65_V	2.320	0.99
28_D	31_Q	2.261	0.98
81_A	85_G	2.174	0.98
52_G	81_A	2.013	0.96
45_G	73_F	1.976	0.96
55_V	84_E	1.837	0.94
50_G	89_Y	1.805	0.94
61_A	95_V	1.546	0.87
85_G	92_L	1.400	0.81
93_F	98_L	1.399	0.81
59_A	80_V	1.351	0.78
24_Q	70_R	1.342	0.78
92_L	98_L	1.322	0.77
48_A	84_E	1.291	0.75
39_G	61_A	1.277	0.74
41_G	52_G	1.220	0.71
38_I	68_E	1.199	0.69
72_M	82_I	1.181	0.68
41_G	46_L	1.177	0.68
51_A	76_V	1.177	0.68
52_G	56_G	1.152	0.66
44_V	87_A	1.148	0.66
79_F	84_E	1.145	0.66
40_A	87_A	1.107	0.63
83_G	86_I	1.088	0.62
32_G	40_A	1.086	0.61
26_P	29_T	1.062	0.60
25_A	94_A	1.056	0.59
58_A	64_G	1.052	0.59
54_A	83_G	1.030	0.57
72_M	75_T	1.029	0.57
19_V	91_I	1.019	0.56
80_V	84_E	1.008	0.56
47_A	85_G	0.998	0.55
50_G	90_G	0.985	0.54
62_G	96_L	0.985	0.54
47_A	77_L	0.985	0.54
36_I	47_A	0.977	0.53
45_G	49_I	0.969	0.53
54_A	89_Y	0.964	0.52
42_L	97_M	0.955	0.52
39_G	50_G	0.947	0.51
73_F	80_V	0.937	0.50
29_T	32_G	0.913	0.48
23_A	26_P	0.903	0.48
50_G	54_A	0.873	0.45
63_V	94_A	0.855	0.44
51_A	55_V	0.849	0.44
67_T	70_R	0.842	0.43
29_T	96_L	0.836	0.43
84_E	87_A	0.833	0.42
42_L	49_I	0.825	0.42
51_A	84_E	0.803	0.40
57_M	60_A	0.789	0.39
25_A	30_A	0.784	0.39
19_V	22_A	0.770	0.38
73_F	78_I	0.762	0.37
39_G	70_R	0.760	0.37
40_A	68_E	0.757	0.37
37_N	88_V	0.740	0.36
82_I	85_G	0.740	0.36
21_A	24_Q	0.732	0.35
61_A	75_T	0.719	0.34
59_A	98_L	0.711	0.34
37_N	41_G	0.710	0.33
51_A	66_L	0.707	0.33
77_L	83_G	0.705	0.33
74_G	88_V	0.705	0.33
20_I	59_A	0.692	0.32
60_A	88_V	0.687	0.32
55_V	82_I	0.686	0.32
39_G	46_L	0.685	0.32
73_F	79_F	0.684	0.32
78_I	86_I	0.682	0.32
25_A	42_L	0.680	0.31
49_I	94_A	0.673	0.31
53_I	60_A	0.666	0.31
29_T	98_L	0.666	0.31
53_I	85_G	0.665	0.30
43_A	94_A	0.663	0.30
67_T	88_V	0.660	0.30
37_N	86_I	0.658	0.30
61_A	78_I	0.650	0.29
20_I	45_G	0.646	0.29
83_G	87_A	0.640	0.29
83_G	88_V	0.639	0.29
64_G	96_L	0.633	0.28
68_E	88_V	0.628	0.28
46_L	71_D	0.626	0.28
38_I	76_V	0.625	0.28
61_A	84_E	0.624	0.28
59_A	63_V	0.619	0.28
59_A	76_V	0.616	0.27
47_A	51_A	0.613	0.27
51_A	89_Y	0.611	0.27
48_A	75_T	0.608	0.27
73_F	97_M	0.604	0.27
33_F	36_I	0.601	0.26
63_V	84_E	0.593	0.26
62_G	91_I	0.590	0.26
26_P	36_I	0.575	0.25
44_V	96_L	0.573	0.25
38_I	44_V	0.567	0.24
87_A	92_L	0.564	0.24
48_A	87_A	0.545	0.23
30_A	59_A	0.543	0.23
22_A	91_I	0.537	0.23
30_A	47_A	0.534	0.23
86_I	96_L	0.530	0.22
74_G	82_I	0.521	0.22
20_I	24_Q	0.519	0.22
30_A	88_V	0.514	0.22
75_T	96_L	0.502	0.21
82_I	92_L	0.500	0.21
19_V	28_D	0.500	0.21

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j9tY	3	0.6765	99.6	0.442	Contact Map
2bl2A	3	0.7941	99.5	0.46	Contact Map
4v1gA	3	0.7745	99.3	0.532	Contact Map
4bemJ	1	0.9118	99.3	0.534	Contact Map
2xquA	3	0.7451	99.3	0.538	Contact Map
1wu0A	1	0.6667	99.3	0.539	Contact Map
3zk1A	5	0.7745	99.2	0.547	Contact Map
4cbkA	3	0.6373	99.2	0.547	Contact Map
1a91A	1	0.7353	99.2	0.559	Contact Map
4bemA	3	0.7451	99.2	0.562	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.