HJC - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HJC - Holliday junction resolvase Hjc

UniProt:	Q7LXU0	Sequences: MNAKKRKGSAVERNIVSRLRDKGFAVVRAPASGSKRKDPIPDIIALKNGVIILIEMKSRKDIEGKIYVRREQAEGIIEFARKSGGSLFLGVKKPGVLKFIPFEKLRRTETGNYVADSEIEGLDLEDLVRLVEAKISRTLDNFL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	143 (125)
Sequences:	118 (85)
Seq/√Len:	7.6

HALSA - Q9HN49
SULSO - HJC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
87_L	102_F	3.020	0.86
5_K	9_S	2.959	0.85
27_V	44_I	2.938	0.85
47_K	51_I	2.705	0.79
7_K	60_K	2.519	0.74
46_L	83_S	2.516	0.74
33_G	41_P	2.469	0.72
53_L	85_G	2.432	0.71
16_V	43_I	2.180	0.62
19_L	124_L	2.137	0.61
5_K	31_A	2.065	0.58
50_V	86_S	2.011	0.56
68_V	72_Q	1.995	0.55
15_I	97_L	1.995	0.55
5_K	30_P	1.990	0.55
126_D	129_R	1.911	0.52
31_A	35_K	1.909	0.52
124_L	128_V	1.836	0.49
26_V	39_P	1.833	0.49
99_F	112_N	1.820	0.48
29_A	35_K	1.716	0.44
104_K	120_E	1.712	0.44
24_F	79_F	1.672	0.42
93_K	115_A	1.666	0.42
30_P	41_P	1.638	0.41
45_A	91_V	1.613	0.40
19_L	45_A	1.611	0.40
69_R	127_L	1.583	0.39
43_I	120_E	1.573	0.38
21_D	100_I	1.570	0.38
59_R	98_K	1.526	0.37
41_P	72_Q	1.519	0.36
75_G	121_G	1.418	0.33
25_A	84_G	1.404	0.32
86_S	115_A	1.393	0.32
14_N	20_R	1.379	0.31
30_P	72_Q	1.373	0.31
44_I	87_L	1.371	0.31
22_K	115_A	1.369	0.31
100_I	125_E	1.226	0.26
33_G	72_Q	1.221	0.26
9_S	96_V	1.220	0.26
70_R	91_V	1.208	0.26
7_K	98_K	1.204	0.26
26_V	71_E	1.201	0.26
129_R	133_A	1.190	0.25
26_V	29_A	1.189	0.25
70_R	128_V	1.184	0.25
59_R	94_P	1.177	0.25
7_K	82_K	1.170	0.25
45_A	110_T	1.168	0.25
52_I	85_G	1.149	0.24
19_L	26_V	1.143	0.24
123_D	126_D	1.105	0.23
25_A	79_F	1.093	0.22
29_A	33_G	1.084	0.22
5_K	41_P	1.075	0.22
73_A	76_I	1.070	0.22
88_F	116_D	1.063	0.22
14_N	97_L	1.045	0.21
76_I	102_F	1.043	0.21
66_I	90_G	1.028	0.21
30_P	111_G	1.022	0.21
20_R	72_Q	1.020	0.21
15_I	76_I	1.006	0.20
73_A	133_A	0.999	0.20
48_N	115_A	0.982	0.20
9_S	34_S	0.973	0.19
67_Y	121_G	0.969	0.19
20_R	33_G	0.960	0.19
67_Y	114_V	0.953	0.19
54_I	99_F	0.945	0.19
47_K	54_I	0.945	0.19
86_S	103_E	0.938	0.18
52_I	127_L	0.936	0.18
44_I	77_I	0.936	0.18
73_A	102_F	0.934	0.18
46_L	129_R	0.932	0.18
61_D	68_V	0.913	0.18
18_R	22_K	0.906	0.18
106_R	114_V	0.903	0.18
27_V	74_E	0.896	0.17
31_A	111_G	0.891	0.17
83_S	129_R	0.886	0.17
50_V	66_I	0.874	0.17
71_E	123_D	0.872	0.17
85_G	89_L	0.867	0.17
97_L	114_V	0.853	0.17
38_D	87_L	0.853	0.17
22_K	125_E	0.841	0.16
21_D	74_E	0.841	0.16
77_I	102_F	0.830	0.16
41_P	108_T	0.826	0.16
53_L	97_L	0.825	0.16
10_A	89_L	0.818	0.16
26_V	85_G	0.805	0.15
61_D	101_P	0.791	0.15
25_A	97_L	0.790	0.15
7_K	65_K	0.790	0.15
105_L	113_Y	0.783	0.15
90_G	111_G	0.781	0.15
17_S	65_K	0.781	0.15
44_I	124_L	0.773	0.15
89_L	125_E	0.766	0.15
8_G	59_R	0.751	0.14
31_A	67_Y	0.743	0.14
66_I	114_V	0.741	0.14
33_G	108_T	0.738	0.14
67_Y	84_G	0.725	0.14
19_L	78_E	0.725	0.14
15_I	35_K	0.713	0.14
76_I	130_L	0.713	0.14
50_V	89_L	0.712	0.14
53_L	129_R	0.711	0.14
107_R	128_V	0.704	0.13
10_A	14_N	0.704	0.13
77_I	125_E	0.693	0.13
65_K	114_V	0.692	0.13
25_A	31_A	0.689	0.13
20_R	41_P	0.688	0.13
78_E	81_R	0.676	0.13
58_S	85_G	0.674	0.13
43_I	91_V	0.672	0.13
89_L	124_L	0.668	0.13
23_G	27_V	0.654	0.13
48_N	93_K	0.652	0.13
5_K	20_R	0.650	0.13
58_S	64_G	0.648	0.12
27_V	116_D	0.646	0.12
77_I	81_R	0.645	0.12
33_G	127_L	0.643	0.12
81_R	111_G	0.639	0.12
29_A	41_P	0.637	0.12
6_R	125_E	0.630	0.12
112_N	115_A	0.630	0.12
31_A	41_P	0.630	0.12
73_A	132_E	0.629	0.12
34_S	88_F	0.627	0.12
60_K	121_G	0.626	0.12
24_F	84_G	0.626	0.12
19_L	58_S	0.609	0.12
76_I	97_L	0.601	0.12
99_F	108_T	0.594	0.12
54_I	118_E	0.588	0.11
17_S	132_E	0.586	0.11
19_L	132_E	0.584	0.11
11_V	111_G	0.578	0.11
17_S	60_K	0.576	0.11
120_E	133_A	0.575	0.11
20_R	97_L	0.574	0.11
48_N	97_L	0.569	0.11
51_I	54_I	0.568	0.11
89_L	118_E	0.566	0.11
54_I	64_G	0.563	0.11
76_I	87_L	0.560	0.11
81_R	101_P	0.558	0.11
116_D	122_L	0.555	0.11
126_D	130_L	0.555	0.11
70_R	87_L	0.554	0.11
35_K	85_G	0.550	0.11
35_K	40_I	0.547	0.11
51_I	56_M	0.545	0.11
16_V	26_V	0.541	0.11
30_P	108_T	0.534	0.11
20_R	102_F	0.534	0.11
53_L	76_I	0.534	0.11
71_E	98_K	0.533	0.11
6_R	92_K	0.526	0.11
9_S	13_R	0.523	0.10
30_P	45_A	0.521	0.10
10_A	85_G	0.519	0.10
29_A	90_G	0.513	0.10
77_I	110_T	0.508	0.10
43_I	116_D	0.508	0.10
28_R	57_K	0.500	0.10
42_D	57_K	0.500	0.10
12_E	57_K	0.500	0.10
12_E	55_E	0.500	0.10
42_D	55_E	0.500	0.10
12_E	42_D	0.500	0.10
12_E	28_R	0.500	0.10
32_S	57_K	0.500	0.10
28_R	42_D	0.500	0.10
32_S	55_E	0.500	0.10
32_S	42_D	0.500	0.10
12_E	32_S	0.500	0.10
28_R	32_S	0.500	0.10
28_R	55_E	0.500	0.10

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2eo0A	2	0.8951	100	0.464	Contact Map
1hh1A	2	0.8741	100	0.476	Contact Map
2wcwA	2	0.8671	99.9	0.528	Contact Map
1ob8A	1	0.8601	99.9	0.583	Contact Map
1gefA	2	0.8322	99.8	0.626	Contact Map
2ostA	4	0.9161	96.9	0.87	Contact Map
1y88A	5	0.8811	95.7	0.885	Contact Map
3fovA	2	0.6503	95.3	0.888	Contact Map
2fcoA	2	0.8601	94.8	0.891	Contact Map
4qbnA	2	0.5944	93.2	0.898	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.