Q7LXT1 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXT1 - Uncharacterized protein

UniProt:	Q7LXT1	Sequences: MFTRTGDDGNTNVISKRVGKDSPVVNLLGDIDELNSFIGLALTKIEWEDMQSDLMRVQTELFILGEEIIQDKGRINEETIKWLESRTVEYRKESGPVKLFVIPGGSEQASYLHVVRSIARRVERNAVAYSKELNFNKWIIVYLNRLSSLLFSMAIVANKRKNVKERIYDIGKYF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	174 (168)
Sequences:	2444 (1579)
Seq/√Len:	121.8

BACSU - PDUO
HALSA - Q9HPN7
SULSO - Q7LXT1 Q980D7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
34_L	119_A	3.982	1.00
126_A	143_L	3.697	1.00
21_D	131_K	2.966	1.00
2_F	88_V	2.818	1.00
26_N	125_N	2.693	1.00
12_N	17_R	2.677	1.00
37_F	114_V	2.509	1.00
38_I	54_L	2.424	1.00
41_A	112_L	2.365	1.00
77_E	81_K	2.347	1.00
21_D	128_A	2.332	1.00
42_L	51_Q	2.294	1.00
44_K	107_E	2.239	1.00
37_F	118_I	2.220	1.00
14_I	69_I	2.095	1.00
25_V	28_L	2.021	1.00
53_D	86_R	2.015	1.00
60_E	142_Y	1.992	1.00
53_D	149_L	1.910	1.00
38_I	150_L	1.881	1.00
156_V	160_R	1.866	1.00
19_G	131_K	1.863	1.00
30_D	125_N	1.856	1.00
60_E	79_T	1.800	1.00
77_E	138_W	1.796	1.00
5_T	12_N	1.787	1.00
149_L	153_M	1.780	1.00
107_E	111_Y	1.728	1.00
118_I	121_R	1.721	1.00
53_D	90_Y	1.668	1.00
26_N	30_D	1.641	1.00
21_D	127_V	1.637	1.00
82_W	86_R	1.628	1.00
93_E	160_R	1.622	1.00
109_A	158_N	1.619	1.00
62_F	65_G	1.594	1.00
67_E	136_N	1.579	1.00
1_M	152_S	1.534	1.00
115_V	150_L	1.525	1.00
90_Y	149_L	1.520	1.00
86_R	89_E	1.516	1.00
112_L	157_A	1.464	1.00
37_F	115_V	1.440	1.00
22_S	133_L	1.436	1.00
125_N	128_A	1.405	1.00
81_K	85_S	1.385	1.00
80_I	138_W	1.354	1.00
129_Y	133_L	1.344	1.00
2_F	84_E	1.342	1.00
68_I	126_A	1.337	1.00
11_T	25_V	1.312	1.00
158_N	165_E	1.310	1.00
50_M	153_M	1.296	1.00
33_E	121_R	1.295	1.00
35_N	62_F	1.281	1.00
50_M	157_A	1.276	1.00
36_S	117_S	1.256	1.00
44_K	111_Y	1.243	0.99
18_V	22_S	1.224	0.99
40_L	114_V	1.220	0.99
56_R	82_W	1.210	0.99
91_R	152_S	1.198	0.99
40_L	111_Y	1.189	0.99
77_E	141_V	1.168	0.99
106_S	158_N	1.160	0.99
75_I	79_T	1.158	0.99
94_S	152_S	1.136	0.99
28_L	68_I	1.131	0.99
10_N	19_G	1.130	0.99
111_Y	114_V	1.117	0.99
37_F	111_Y	1.113	0.99
90_Y	156_V	1.107	0.99
49_D	89_E	1.100	0.99
2_F	87_T	1.099	0.99
43_T	107_E	1.079	0.98
41_A	115_V	1.079	0.98
43_T	110_S	1.074	0.98
67_E	74_R	1.058	0.98
87_T	152_S	1.035	0.98
41_A	157_A	1.030	0.98
19_G	22_S	1.021	0.98
27_L	126_A	1.019	0.98
60_E	82_W	1.019	0.98
14_I	70_Q	1.016	0.98
86_R	149_L	1.009	0.98
70_Q	73_G	1.009	0.98
49_D	160_R	1.005	0.98
45_I	108_Q	1.002	0.98
130_S	140_I	0.993	0.97
108_Q	157_A	0.976	0.97
5_T	17_R	0.975	0.97
57_V	142_Y	0.964	0.97
5_T	10_N	0.964	0.97
37_F	41_A	0.944	0.96
24_V	133_L	0.935	0.96
42_L	55_M	0.934	0.96
95_G	159_K	0.933	0.96
138_W	141_V	0.933	0.96
99_L	167_I	0.931	0.96
30_D	121_R	0.929	0.96
98_K	167_I	0.920	0.96
26_N	128_A	0.915	0.96
43_T	111_Y	0.901	0.95
13_V	18_V	0.884	0.95
64_L	139_I	0.883	0.95
100_F	151_F	0.881	0.95
126_A	139_I	0.879	0.95
51_Q	55_M	0.873	0.95
35_N	65_G	0.867	0.94
35_N	58_Q	0.866	0.94
109_A	165_E	0.855	0.94
32_D	116_R	0.851	0.94
31_I	61_L	0.846	0.94
59_T	63_I	0.844	0.93
128_A	132_E	0.827	0.93
159_K	164_K	0.826	0.93
122_V	143_L	0.825	0.93
12_N	15_S	0.819	0.92
53_D	89_E	0.814	0.92
55_M	166_R	0.811	0.92
84_E	88_V	0.808	0.92
89_E	93_E	0.803	0.92
22_S	132_E	0.798	0.91
78_E	81_K	0.798	0.91
30_D	122_V	0.797	0.91
90_Y	153_M	0.796	0.91
23_P	125_N	0.795	0.91
24_V	28_L	0.792	0.91
119_A	150_L	0.791	0.91
56_R	60_E	0.787	0.91
39_G	58_Q	0.784	0.91
105_G	158_N	0.780	0.90
5_T	8_D	0.773	0.90
76_N	79_T	0.772	0.90
31_I	64_L	0.770	0.90
40_L	107_E	0.768	0.90
28_L	117_S	0.767	0.90
54_L	112_L	0.748	0.89
94_S	97_V	0.747	0.88
114_V	118_I	0.746	0.88
11_T	18_V	0.741	0.88
130_S	135_F	0.740	0.88
130_S	134_N	0.739	0.88
86_R	90_Y	0.734	0.88
34_L	115_V	0.734	0.88
30_D	118_I	0.733	0.88
80_I	141_V	0.728	0.87
148_S	155_I	0.727	0.87
91_R	94_S	0.720	0.87
84_E	87_T	0.716	0.86
8_D	137_K	0.715	0.86
106_S	109_A	0.710	0.86
66_E	70_Q	0.709	0.86
8_D	12_N	0.708	0.86
53_D	82_W	0.705	0.85
56_R	86_R	0.702	0.85
23_P	132_E	0.699	0.85
48_E	52_S	0.688	0.84
41_A	111_Y	0.683	0.84
40_L	44_K	0.680	0.83
27_L	125_N	0.675	0.83
18_V	25_V	0.669	0.82
106_S	163_V	0.668	0.82
103_P	116_R	0.666	0.82
4_R	81_K	0.666	0.82
102_I	105_G	0.663	0.82
112_L	153_M	0.659	0.81
111_Y	115_V	0.656	0.81
27_L	31_I	0.651	0.81
101_V	151_F	0.649	0.80
39_G	65_G	0.648	0.80
136_N	139_I	0.647	0.80
126_A	140_I	0.644	0.80
63_I	168_Y	0.644	0.80
127_V	140_I	0.635	0.79
104_G	110_S	0.633	0.79
101_V	154_A	0.632	0.79
28_L	88_V	0.620	0.77
93_E	156_V	0.620	0.77
127_V	130_S	0.619	0.77
85_S	89_E	0.616	0.77
89_E	92_K	0.616	0.77
13_V	24_V	0.615	0.77
27_L	129_Y	0.614	0.77
35_N	105_G	0.611	0.76
109_A	154_A	0.608	0.76
45_I	157_A	0.607	0.76
97_V	151_F	0.606	0.76
57_V	146_L	0.606	0.76
65_G	105_G	0.601	0.75
33_E	118_I	0.600	0.75
31_I	143_L	0.599	0.75
4_R	141_V	0.598	0.75
106_S	165_E	0.598	0.75
1_M	94_S	0.595	0.74
94_S	99_L	0.594	0.74
29_G	32_D	0.589	0.74
62_F	168_Y	0.588	0.74
113_H	154_A	0.588	0.74
50_M	156_V	0.586	0.73
11_T	24_V	0.584	0.73
23_P	27_L	0.583	0.73
58_Q	65_G	0.581	0.73
19_G	127_V	0.580	0.73
50_M	90_Y	0.579	0.72
59_T	168_Y	0.578	0.72
159_K	163_V	0.578	0.72
101_V	155_I	0.578	0.72
34_L	37_F	0.574	0.72
47_W	160_R	0.570	0.71
8_D	17_R	0.570	0.71
6_G	9_G	0.566	0.71
16_K	71_D	0.560	0.70
48_E	51_Q	0.559	0.70
55_M	59_T	0.558	0.70
75_I	138_W	0.558	0.70
31_I	122_V	0.555	0.69
23_P	128_A	0.553	0.69
72_K	134_N	0.551	0.69
4_R	77_E	0.551	0.69
30_D	124_R	0.549	0.68
34_L	41_A	0.549	0.68
36_S	154_A	0.543	0.68
12_N	16_K	0.539	0.67
14_I	91_R	0.538	0.67
119_A	146_L	0.538	0.67
43_T	106_S	0.537	0.67
113_H	155_I	0.534	0.66
129_Y	135_F	0.532	0.66
122_V	129_Y	0.529	0.66
109_A	112_L	0.528	0.65
151_F	158_N	0.526	0.65
108_Q	111_Y	0.523	0.65
49_D	93_E	0.520	0.64
107_E	110_S	0.520	0.64
24_V	68_I	0.518	0.64
36_S	40_L	0.518	0.64
42_L	166_R	0.517	0.64
35_N	103_P	0.517	0.64
32_D	154_A	0.516	0.64
90_Y	168_Y	0.513	0.63
59_T	62_F	0.512	0.63
56_R	138_W	0.511	0.63
129_Y	134_N	0.510	0.63
52_S	92_K	0.508	0.62
57_V	90_Y	0.507	0.62
137_K	141_V	0.505	0.62
50_M	149_L	0.504	0.62
88_V	148_S	0.503	0.62
49_D	52_S	0.501	0.61
94_S	168_Y	0.501	0.61
114_V	117_S	0.500	0.61

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1rtyA	3	0.908	100	0.076	Contact Map
1nogA	4	0.8448	100	0.076	Contact Map
1wozA	3	0.8966	100	0.078	Contact Map
2nt8A	3	0.977	100	0.078	Contact Map
3ke4A	3	0.9483	100	0.079	Contact Map
2ah6A	3	0.9023	100	0.08	Contact Map
3ci3A	3	1	100	0.082	Contact Map
2zhyA	3	0.9598	100	0.085	Contact Map
2idxA	3	0.977	100	0.089	Contact Map
2g2dA	3	0.8563	100	0.1	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.