Q7LXS9 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXS9 - Uncharacterized protein

UniProt:	Q7LXS9	Sequences: MSSQQQKVDKEEWKKKIMEALKDVYDPEIPVDIVNLGLIYDLKINDDGDVYLRLGLTAPGCPVVDDLIYTVEQVIKESVPAKSVEVDIDLDTQWTPLKMTAEGREKFKQLYGYDIVEMWVQTYGLPADEQKS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	132 (101)
Sequences:	2093 (1130)
Seq/√Len:	112.5

ECOLI - PAAD
BACSU - YITW
SULSO - Q7LXS9 Q97X89 Q97YS5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
32_D	35_N	3.885	1.00
41_D	53_R	3.077	1.00
51_Y	85_E	2.724	1.00
49_D	83_S	2.650	1.00
53_R	87_D	2.526	1.00
105_E	108_K	2.314	1.00
95_T	98_K	2.161	1.00
51_Y	87_D	2.134	1.00
72_E	76_K	2.096	1.00
53_R	89_D	2.067	1.00
54_L	71_V	2.044	1.00
44_I	50_V	2.011	1.00
99_M	103_G	1.900	1.00
38_L	67_L	1.840	1.00
45_N	49_D	1.820	1.00
33_I	39_I	1.813	1.00
52_L	75_I	1.780	1.00
29_I	110_L	1.738	1.00
18_M	34_V	1.721	1.00
66_D	70_T	1.652	1.00
49_D	85_E	1.629	1.00
35_N	103_G	1.610	1.00
49_D	82_K	1.560	1.00
22_K	102_E	1.546	1.00
40_Y	98_K	1.449	1.00
34_V	39_I	1.427	1.00
54_L	64_V	1.394	1.00
33_I	67_L	1.377	1.00
102_E	106_K	1.343	1.00
55_G	92_T	1.336	1.00
45_N	51_Y	1.333	1.00
89_D	92_T	1.300	0.99
70_T	73_Q	1.291	0.99
21_L	34_V	1.277	0.99
23_D	74_V	1.206	0.99
35_N	106_K	1.204	0.99
25_Y	30_P	1.198	0.99
76_K	84_V	1.186	0.99
69_Y	72_E	1.172	0.99
24_V	74_V	1.170	0.99
22_K	35_N	1.150	0.99
39_I	71_V	1.114	0.98
16_K	19_E	1.108	0.98
25_Y	29_I	1.106	0.98
15_K	19_E	1.104	0.98
20_A	74_V	1.077	0.98
56_L	63_V	1.077	0.98
11_E	14_K	1.066	0.98
100_T	103_G	1.062	0.98
105_E	109_Q	1.058	0.98
16_K	80_P	1.022	0.97
68_I	72_E	1.017	0.97
75_I	78_S	1.017	0.97
31_V	110_L	1.007	0.97
30_P	58_A	1.003	0.97
21_L	39_I	0.966	0.96
14_K	18_M	0.965	0.96
48_G	82_K	0.955	0.96
22_K	32_D	0.955	0.96
43_K	53_R	0.931	0.95
11_E	15_K	0.923	0.95
68_I	86_V	0.922	0.95
65_D	70_T	0.911	0.95
30_P	63_V	0.899	0.94
69_Y	73_Q	0.895	0.94
20_A	79_V	0.875	0.93
68_I	88_I	0.856	0.93
47_D	82_K	0.854	0.92
101_A	105_E	0.852	0.92
97_L	107_F	0.848	0.92
103_G	108_K	0.847	0.92
43_K	51_Y	0.841	0.92
20_A	24_V	0.840	0.92
38_L	54_L	0.826	0.91
40_Y	55_G	0.823	0.91
102_E	105_E	0.808	0.90
21_L	71_V	0.808	0.90
17_I	75_I	0.801	0.90
10_K	46_D	0.780	0.89
42_L	62_P	0.775	0.88
20_A	81_A	0.766	0.88
76_K	83_S	0.764	0.88
58_A	98_K	0.751	0.87
14_K	42_L	0.741	0.86
90_L	93_Q	0.736	0.86
38_L	56_L	0.715	0.84
20_A	78_S	0.708	0.83
64_V	67_L	0.704	0.83
64_V	68_I	0.703	0.83
14_K	41_D	0.689	0.82
13_W	81_A	0.686	0.81
35_N	102_E	0.684	0.81
20_A	77_E	0.680	0.81
70_T	74_V	0.678	0.81
12_E	16_K	0.669	0.80
56_L	90_L	0.669	0.80
76_K	82_K	0.667	0.79
67_L	96_P	0.662	0.79
50_V	81_A	0.656	0.78
58_A	88_I	0.647	0.77
71_V	86_V	0.647	0.77
99_M	107_F	0.641	0.77
96_P	104_R	0.640	0.77
59_P	98_K	0.630	0.76
41_D	51_Y	0.627	0.75
59_P	90_L	0.623	0.75
25_Y	32_D	0.616	0.74
72_E	85_E	0.616	0.74
33_I	89_D	0.613	0.74
10_K	13_W	0.605	0.73
15_K	51_Y	0.604	0.72
103_G	109_Q	0.599	0.72
22_K	34_V	0.598	0.72
99_M	104_R	0.598	0.72
58_A	62_P	0.597	0.72
38_L	64_V	0.596	0.71
39_I	64_V	0.592	0.71
37_G	57_T	0.591	0.71
42_L	50_V	0.588	0.70
24_V	33_I	0.587	0.70
58_A	63_V	0.576	0.69
40_Y	92_T	0.576	0.69
13_W	44_I	0.572	0.68
28_E	37_G	0.568	0.68
62_P	74_V	0.568	0.68
58_A	64_V	0.564	0.67
60_G	96_P	0.563	0.67
58_A	96_P	0.560	0.67
55_G	98_K	0.556	0.66
54_L	67_L	0.556	0.66
32_D	102_E	0.550	0.65
12_E	15_K	0.545	0.65
29_I	101_A	0.537	0.64
74_V	79_V	0.535	0.63
71_V	75_I	0.533	0.63
60_G	69_Y	0.531	0.63
20_A	23_D	0.530	0.63
16_K	79_V	0.529	0.62
75_I	84_V	0.526	0.62
42_L	63_V	0.524	0.62
93_Q	98_K	0.522	0.61
21_L	33_I	0.522	0.61
30_P	59_P	0.513	0.60
19_E	43_K	0.513	0.60
25_Y	38_L	0.512	0.60
28_E	57_T	0.511	0.60
30_P	96_P	0.509	0.59
52_L	71_V	0.507	0.59
40_Y	56_L	0.504	0.59
56_L	60_G	0.502	0.58
54_L	90_L	0.500	0.58
55_G	64_V	0.500	0.58

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3lnoA	1	0.8106	100	0.372	Contact Map
1uwdA	1	0.7727	100	0.398	Contact Map
3cq1A	2	0.75	100	0.403	Contact Map
3ux2A	2	0.8712	99.9	0.433	Contact Map
2m5oA	1	0.6742	91.2	0.885	Contact Map
1vehA	1	0.6742	88.9	0.89	Contact Map
1xhjA	1	0.6515	88.2	0.892	Contact Map
1yg0A	1	0.4773	33.1	0.928	Contact Map
2aj0A	1	0.4773	28.2	0.931	Contact Map
4q2lA	1	0.4242	25.3	0.932	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.