Q7LXS6 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXS6 - Transcriptional regulator, putative

UniProt:	Q7LXS6	Sequences: MSDSKKRTVDLDAIDRRLLIELTRDARTSLRRLAEEMNVSPATLHNRMTRMVQEGMIKSFVALLDYSKLGFALTGIIMAKVDGKHLVEFEKEIANADNVTAVYDVVGEYDVVIIAKFRSVEELDSFLKQLLKNPKIERTYTSIVLNVVKEDPRIRIF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	157 (140)
Sequences:	13727 (8876)
Seq/√Len:	750.2

ECOLI - LRP YBAO ASNC
BACSU - YWRC AZLB YUGG LRPB LRPC YEZC LRPA
HALSA - Q9HQ13 Q9HNI1 Q9HQ33 Q9HQB6 Q9HP41 Q9HQG1 Q9HP70 Q9HNW8
SULSO - Q7LXS6 Q97W90 Q97XP7 Q7LX67 LYSM Q97X78 Q980P3 Q97VN7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
21_E	36_E	2.917	1.00
52_V	60_F	2.845	1.00
80_K	138_R	2.550	1.00
108_E	140_Y	2.542	1.00
101_A	114_I	2.530	1.00
30_L	48_M	2.299	1.00
118_R	122_E	2.288	1.00
67_S	121_E	2.105	1.00
15_D	47_R	2.079	1.00
21_E	28_T	2.012	1.00
50_R	54_E	2.009	1.00
58_K	65_D	1.970	1.00
96_A	129_Q	1.939	1.00
82_D	137_E	1.887	1.00
58_K	63_L	1.808	1.00
74_T	114_I	1.803	1.00
76_I	103_Y	1.790	1.00
100_T	116_K	1.734	1.00
14_I	39_V	1.733	1.00
96_A	126_F	1.713	1.00
49_T	53_Q	1.687	1.00
21_E	24_R	1.668	1.00
39_V	43_T	1.632	1.00
78_M	142_S	1.597	1.00
31_R	35_E	1.595	1.00
28_T	36_E	1.551	1.00
92_E	133_N	1.532	1.00
119_S	122_E	1.528	1.00
122_E	125_S	1.517	1.00
92_E	95_N	1.513	1.00
32_R	35_E	1.502	1.00
31_R	41_P	1.496	1.00
98_N	122_E	1.475	1.00
39_V	44_L	1.460	1.00
40_S	43_T	1.432	1.00
30_L	45_H	1.403	1.00
79_A	113_I	1.394	1.00
18_L	33_L	1.388	1.00
147_V	150_E	1.386	1.00
89_F	93_I	1.379	1.00
90_E	94_A	1.373	1.00
80_K	108_E	1.360	1.00
27_R	60_F	1.357	1.00
37_M	44_L	1.333	1.00
78_M	109_Y	1.322	1.00
87_V	91_K	1.304	1.00
125_S	128_K	1.299	1.00
13_A	17_R	1.284	1.00
85_H	88_E	1.279	1.00
73_L	120_V	1.267	1.00
71_F	118_R	1.260	1.00
32_R	36_E	1.259	1.00
77_I	115_A	1.257	1.00
28_T	33_L	1.231	1.00
81_V	89_F	1.223	1.00
80_K	137_E	1.206	1.00
14_I	17_R	1.203	1.00
22_L	48_M	1.199	1.00
24_R	36_E	1.199	1.00
124_D	146_N	1.180	1.00
90_E	146_N	1.175	1.00
49_T	52_V	1.173	1.00
29_S	32_R	1.148	1.00
12_D	47_R	1.144	1.00
98_N	129_Q	1.127	1.00
25_D	36_E	1.118	1.00
21_E	33_L	1.101	1.00
14_I	37_M	1.093	1.00
78_M	140_Y	1.093	1.00
59_S	63_L	1.088	1.00
74_T	116_K	1.075	1.00
30_L	34_A	1.064	1.00
17_R	20_I	1.037	1.00
99_V	115_A	1.023	1.00
17_R	21_E	1.021	1.00
102_V	113_I	0.998	1.00
90_E	111_V	0.989	1.00
20_I	24_R	0.986	1.00
117_F	122_E	0.986	1.00
28_T	32_R	0.983	1.00
45_H	49_T	0.981	1.00
65_D	68_K	0.976	1.00
26_A	60_F	0.966	1.00
88_E	92_E	0.962	1.00
34_A	44_L	0.955	1.00
27_R	52_V	0.952	1.00
91_K	94_A	0.951	1.00
76_I	112_V	0.947	1.00
105_V	112_V	0.938	1.00
41_P	45_H	0.933	1.00
103_Y	114_I	0.917	1.00
117_F	123_L	0.917	1.00
91_K	95_N	0.914	1.00
76_I	114_I	0.910	1.00
108_E	138_R	0.905	1.00
117_F	126_F	0.903	1.00
17_R	37_M	0.903	1.00
115_A	126_F	0.898	1.00
30_L	41_P	0.897	1.00
34_A	39_V	0.890	1.00
31_R	45_H	0.871	1.00
72_A	119_S	0.865	1.00
99_V	102_V	0.859	1.00
11_L	16_R	0.856	1.00
66_Y	116_K	0.838	1.00
51_M	56_M	0.826	1.00
82_D	85_H	0.825	1.00
76_I	144_V	0.816	1.00
26_A	32_R	0.809	1.00
99_V	113_I	0.808	1.00
15_D	50_R	0.806	1.00
103_Y	144_V	0.804	1.00
16_R	20_I	0.796	1.00
79_A	89_F	0.794	1.00
127_L	141_T	0.788	1.00
103_Y	147_V	0.782	1.00
42_A	46_N	0.770	1.00
87_V	90_E	0.767	1.00
92_E	96_A	0.764	1.00
93_I	102_V	0.761	1.00
33_L	44_L	0.760	1.00
78_M	112_V	0.758	1.00
26_A	62_A	0.758	1.00
33_L	48_M	0.756	1.00
125_S	129_Q	0.756	1.00
86_L	111_V	0.753	1.00
18_L	47_R	0.747	1.00
131_L	139_T	0.741	1.00
12_D	15_D	0.740	1.00
88_E	91_K	0.724	1.00
109_Y	140_Y	0.722	1.00
18_L	44_L	0.711	1.00
121_E	124_D	0.705	1.00
11_L	56_M	0.702	1.00
106_V	143_I	0.695	1.00
21_E	25_D	0.690	1.00
75_G	123_L	0.688	1.00
82_D	135_K	0.687	1.00
80_K	109_Y	0.685	1.00
18_L	28_T	0.685	1.00
98_N	126_F	0.684	1.00
71_F	98_N	0.682	1.00
71_F	116_K	0.679	1.00
25_D	28_T	0.672	1.00
56_M	68_K	0.670	1.00
90_E	148_V	0.668	1.00
78_M	108_E	0.664	1.00
89_F	111_V	0.664	1.00
77_I	139_T	0.660	1.00
13_A	16_R	0.660	1.00
104_D	111_V	0.659	1.00
120_V	143_I	0.654	1.00
46_N	50_R	0.644	1.00
18_L	21_E	0.642	1.00
77_I	113_I	0.641	1.00
15_D	51_M	0.637	1.00
98_N	118_R	0.633	1.00
74_T	144_V	0.630	1.00
19_L	51_M	0.629	1.00
88_E	135_K	0.629	1.00
75_G	143_I	0.629	1.00
93_I	113_I	0.627	1.00
121_E	125_S	0.623	1.00
34_A	41_P	0.623	1.00
42_A	45_H	0.619	1.00
47_R	51_M	0.619	1.00
46_N	49_T	0.617	1.00
55_G	58_K	0.613	1.00
26_A	59_S	0.612	1.00
18_L	48_M	0.608	1.00
65_D	69_L	0.608	1.00
127_L	139_T	0.605	1.00
64_L	69_L	0.605	1.00
18_L	51_M	0.594	1.00
30_L	44_L	0.592	1.00
105_V	109_Y	0.588	1.00
79_A	136_I	0.588	1.00
122_E	126_F	0.587	1.00
87_V	132_K	0.585	1.00
92_E	134_P	0.577	1.00
129_Q	133_N	0.576	1.00
96_A	133_N	0.575	1.00
101_A	150_E	0.563	1.00
74_T	147_V	0.563	1.00
74_T	103_Y	0.560	1.00
23_T	61_V	0.550	1.00
75_G	141_T	0.550	1.00
85_H	134_P	0.548	1.00
88_E	134_P	0.547	1.00
120_V	145_L	0.546	1.00
57_I	60_F	0.543	1.00
126_F	129_Q	0.543	1.00
14_I	43_T	0.540	1.00
63_L	66_Y	0.537	1.00
104_D	110_D	0.537	1.00
80_K	140_Y	0.534	1.00
79_A	139_T	0.529	1.00
104_D	124_D	0.528	1.00
105_V	142_S	0.524	1.00
50_R	53_Q	0.521	1.00
105_V	144_V	0.517	1.00
31_R	34_A	0.516	1.00
108_E	142_S	0.511	1.00
102_V	148_V	0.510	1.00
126_F	130_L	0.508	1.00
78_M	105_V	0.506	1.00
92_E	135_K	0.503	1.00
121_E	146_N	0.503	1.00
100_T	114_I	0.501	1.00
81_V	110_D	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ch7A	1	0.9236	100	0.15	Contact Map
4un1A	1	0.9045	100	0.183	Contact Map
2e1cA	1	0.9363	100	0.198	Contact Map
4un1B	1	0.949	100	0.207	Contact Map
4pcqA	2	0.9363	100	0.209	Contact Map
2p5vA	5	0.9682	100	0.215	Contact Map
2ia0A	2	0.9172	100	0.219	Contact Map
2pn6A	5	0.9363	100	0.24	Contact Map
3i4pA	5	0.9299	100	0.244	Contact Map
2cg4A	6	0.9363	100	0.25	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.