Q7LXS5 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXS5 - Uncharacterized protein

UniProt:	Q7LXS5	Sequences: MSELVSIPEIAFKLYAIMDPLSILPYLIALYEEFNRNSQNKISWRFLVNKLSIAVTVLLLFFSILGGPLLAFLGISVSALEIGGGIILVYLGVDTLGGFQQLKFLSSRIEEAIITPIATPLIVGPGTMTGLITLSVSNNLIILILGSLLAALLVYLSLLLGPIIIRILGNTGTVAVGRFMAIIIAAFGVQLIIDGISQIKLI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	202 (189)
Sequences:	2442 (1633)
Seq/√Len:	118.8

ECOLI - MARC YCHE YHGN
BACSU - YVBG
SULSO - Q7LXS5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
193_I	199_I	4.085	1.00
35_N	38_S	3.470	1.00
56_T	151_A	3.265	1.00
82_I	193_I	3.152	1.00
59_L	127_T	3.088	1.00
155_Y	159_L	2.840	1.00
90_Y	93_V	2.804	1.00
79_A	190_Q	2.800	1.00
11_A	149_L	2.558	1.00
49_N	155_Y	2.543	1.00
54_A	114_I	2.522	1.00
56_T	148_L	2.495	1.00
78_S	198_Q	2.482	1.00
190_Q	194_D	2.365	1.00
58_L	119_T	2.238	1.00
89_V	192_I	2.157	1.00
7_I	146_G	2.112	1.00
67_G	71_A	2.084	1.00
169_G	172_G	2.071	1.00
53_I	57_V	2.069	1.00
27_L	31_Y	1.964	1.00
11_A	153_L	1.953	1.00
10_I	146_G	1.931	1.00
55_V	151_A	1.894	1.00
64_I	144_I	1.850	1.00
7_I	145_L	1.832	1.00
52_S	151_A	1.827	1.00
92_G	185_A	1.754	1.00
40_N	159_L	1.684	1.00
163_I	166_R	1.684	1.00
94_D	99_F	1.675	1.00
54_A	118_A	1.673	1.00
18_M	150_A	1.672	1.00
60_L	144_I	1.670	1.00
19_D	22_S	1.667	1.00
56_T	60_L	1.665	1.00
78_S	81_E	1.648	1.00
82_I	199_I	1.638	1.00
86_I	89_V	1.547	1.00
135_S	140_L	1.542	1.00
58_L	123_V	1.537	1.00
86_I	192_I	1.527	1.00
59_L	123_V	1.508	1.00
27_L	43_S	1.495	1.00
10_I	134_L	1.484	1.00
14_L	131_L	1.473	1.00
81_E	194_D	1.447	1.00
59_L	131_L	1.388	1.00
122_I	154_V	1.358	1.00
89_V	188_G	1.356	1.00
49_N	159_L	1.356	1.00
79_A	193_I	1.342	1.00
135_S	143_L	1.342	1.00
7_I	149_L	1.341	1.00
60_L	148_L	1.317	1.00
63_S	131_L	1.311	1.00
193_I	196_I	1.300	1.00
27_L	117_I	1.300	1.00
152_L	156_L	1.264	0.99
7_I	11_A	1.262	0.99
95_T	181_A	1.250	0.99
41_K	50_K	1.236	0.99
95_T	180_M	1.230	0.99
113_I	118_A	1.230	0.99
34_F	38_S	1.226	0.99
18_M	151_A	1.223	0.99
85_G	192_I	1.219	0.99
160_L	163_I	1.203	0.99
22_S	25_P	1.193	0.99
39_Q	162_P	1.188	0.99
131_L	147_S	1.177	0.99
51_L	55_V	1.177	0.99
52_S	154_V	1.173	0.99
52_S	155_Y	1.171	0.99
50_K	111_E	1.161	0.99
63_S	144_I	1.160	0.99
36_R	39_Q	1.150	0.99
31_Y	39_Q	1.137	0.99
36_R	40_N	1.126	0.99
57_V	61_F	1.123	0.99
65_L	69_L	1.122	0.99
156_L	160_L	1.119	0.99
49_N	53_I	1.118	0.99
95_T	177_G	1.110	0.99
82_I	196_I	1.109	0.99
163_I	167_I	1.080	0.98
23_I	158_L	1.077	0.98
168_L	172_G	1.067	0.98
184_I	188_G	1.066	0.98
81_E	198_Q	1.065	0.98
14_L	147_S	1.064	0.98
34_F	42_I	1.063	0.98
63_S	135_S	1.061	0.98
82_I	192_I	1.055	0.98
85_G	195_G	1.052	0.98
76_S	190_Q	1.044	0.98
16_A	19_D	1.040	0.98
25_P	28_I	1.019	0.98
58_L	118_A	1.004	0.97
185_A	188_G	0.999	0.97
70_L	186_A	0.992	0.97
16_A	73_L	0.987	0.97
127_T	131_L	0.977	0.97
87_I	185_A	0.953	0.96
19_D	88_L	0.947	0.96
17_I	130_G	0.942	0.96
89_V	93_V	0.942	0.96
18_M	127_T	0.927	0.96
28_I	165_I	0.922	0.96
40_N	49_N	0.917	0.95
59_L	128_M	0.914	0.95
61_F	65_L	0.911	0.95
82_I	195_G	0.910	0.95
63_S	140_L	0.910	0.95
89_V	185_A	0.906	0.95
15_Y	153_L	0.904	0.95
55_V	118_A	0.903	0.95
86_I	93_V	0.902	0.95
87_I	91_L	0.902	0.95
140_L	144_I	0.902	0.95
54_A	113_I	0.899	0.95
17_I	126_G	0.895	0.95
123_V	147_S	0.871	0.94
22_S	26_Y	0.858	0.94
141_I	145_L	0.848	0.93
152_L	163_I	0.842	0.93
51_L	112_A	0.839	0.93
83_G	189_V	0.837	0.93
128_M	132_I	0.837	0.93
27_L	161_G	0.820	0.92
13_K	130_G	0.811	0.92
69_L	128_M	0.810	0.92
100_Q	103_K	0.809	0.91
15_Y	157_S	0.807	0.91
142_I	145_L	0.798	0.91
80_L	129_T	0.792	0.91
40_N	155_Y	0.784	0.90
22_S	154_V	0.783	0.90
62_F	132_I	0.781	0.90
178_R	189_V	0.775	0.90
27_L	125_P	0.768	0.89
23_I	122_I	0.767	0.89
52_S	55_V	0.766	0.89
38_S	42_I	0.763	0.89
88_L	133_T	0.762	0.89
100_Q	105_L	0.761	0.89
71_A	141_I	0.755	0.88
20_P	150_A	0.752	0.88
65_L	68_P	0.752	0.88
6_S	138_N	0.750	0.88
103_K	106_S	0.742	0.88
123_V	181_A	0.742	0.88
80_L	130_G	0.737	0.87
23_I	121_L	0.734	0.87
76_S	79_A	0.733	0.87
19_D	25_P	0.728	0.87
68_P	71_A	0.724	0.86
82_I	189_V	0.716	0.86
87_I	173_T	0.716	0.86
19_D	180_M	0.713	0.85
141_I	144_I	0.710	0.85
36_R	162_P	0.709	0.85
118_A	123_V	0.706	0.85
15_Y	150_A	0.706	0.85
94_D	97_G	0.705	0.85
14_L	59_L	0.702	0.84
80_L	151_A	0.699	0.84
24_L	28_I	0.696	0.84
43_S	176_V	0.694	0.84
98_G	178_R	0.687	0.83
96_L	181_A	0.686	0.83
19_D	62_F	0.685	0.83
146_G	150_A	0.684	0.83
134_L	143_L	0.679	0.82
11_A	146_G	0.677	0.82
27_L	39_Q	0.675	0.82
114_I	171_T	0.672	0.82
139_N	142_I	0.659	0.81
58_L	160_L	0.656	0.80
24_L	158_L	0.655	0.80
150_A	153_L	0.655	0.80
37_N	40_N	0.651	0.80
41_K	196_I	0.648	0.79
16_A	78_S	0.647	0.79
78_S	193_I	0.647	0.79
94_D	103_K	0.646	0.79
20_P	125_P	0.640	0.79
24_L	157_S	0.640	0.79
75_I	101_Q	0.640	0.79
63_S	179_F	0.636	0.78
129_T	132_I	0.636	0.78
79_A	83_G	0.635	0.78
92_G	96_L	0.635	0.78
16_A	185_A	0.630	0.78
41_K	156_L	0.629	0.77
84_G	129_T	0.627	0.77
50_K	54_A	0.627	0.77
171_T	175_A	0.627	0.77
87_I	131_L	0.627	0.77
11_A	15_Y	0.625	0.77
179_F	183_I	0.623	0.77
98_G	181_A	0.620	0.76
87_I	121_L	0.614	0.76
31_Y	34_F	0.612	0.75
27_L	76_S	0.612	0.75
17_I	187_F	0.611	0.75
39_Q	187_F	0.610	0.75
84_G	95_T	0.609	0.75
16_A	182_I	0.607	0.75
42_I	51_L	0.605	0.75
79_A	199_I	0.603	0.74
23_I	87_I	0.603	0.74
111_E	196_I	0.601	0.74
73_L	133_T	0.599	0.74
13_K	17_I	0.594	0.73
70_L	132_I	0.592	0.73
13_K	182_I	0.591	0.73
99_F	102_L	0.589	0.73
84_G	126_G	0.588	0.73
6_S	142_I	0.588	0.73
59_L	147_S	0.587	0.72
63_S	147_S	0.587	0.72
96_L	188_G	0.584	0.72
92_G	174_V	0.584	0.72
19_D	127_T	0.581	0.72
62_F	122_I	0.580	0.72
101_Q	104_F	0.579	0.71
180_M	191_L	0.579	0.71
145_L	149_L	0.578	0.71
112_A	117_I	0.578	0.71
9_E	12_F	0.577	0.71
92_G	188_G	0.576	0.71
98_G	180_M	0.575	0.71
70_L	84_G	0.574	0.71
156_L	159_L	0.572	0.71
90_Y	97_G	0.571	0.70
17_I	58_L	0.568	0.70
98_G	184_I	0.567	0.70
72_F	187_F	0.566	0.70
25_P	121_L	0.564	0.69
119_T	182_I	0.561	0.69
100_Q	106_S	0.558	0.69
25_P	122_I	0.557	0.69
170_N	174_V	0.553	0.68
77_V	92_G	0.552	0.68
19_D	83_G	0.550	0.68
126_G	184_I	0.547	0.67
13_K	74_G	0.546	0.67
107_S	110_E	0.546	0.67
88_L	187_F	0.544	0.67
149_L	167_I	0.544	0.67
98_G	174_V	0.541	0.66
71_A	166_R	0.541	0.66
173_T	182_I	0.540	0.66
168_L	173_T	0.540	0.66
11_A	58_L	0.539	0.66
42_I	117_I	0.538	0.66
127_T	165_I	0.535	0.65
126_G	178_R	0.534	0.65
61_F	108_R	0.533	0.65
96_L	150_A	0.533	0.65
32_E	170_N	0.529	0.65
115_T	184_I	0.529	0.65
102_L	110_E	0.526	0.64
14_L	18_M	0.522	0.64
134_L	149_L	0.522	0.64
121_L	124_G	0.522	0.64
16_A	186_A	0.520	0.63
65_L	133_T	0.516	0.63
28_I	176_V	0.515	0.63
80_L	182_I	0.515	0.63
21_L	70_L	0.512	0.62
37_N	57_V	0.510	0.62
58_L	95_T	0.505	0.61
30_L	112_A	0.504	0.61
54_A	62_F	0.504	0.61
108_R	152_L	0.504	0.61
16_A	177_G	0.503	0.61
42_I	54_A	0.503	0.61
75_I	175_A	0.502	0.61
64_I	131_L	0.502	0.61
113_I	117_I	0.502	0.61
124_G	178_R	0.501	0.60
21_L	180_M	0.500	0.60

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4humA	1	0.8267	22	0.944	Contact Map
3mktA	1	0.8416	13.8	0.949	Contact Map
3w4tA	1	0.7921	12.8	0.949	Contact Map
4lz6A	1	0.8119	12.7	0.949	Contact Map
2cfqA	1	0.5248	8.8	0.953	Contact Map
4wgvA	2	0.401	6	0.956	Contact Map
3pr6A	2	0.2525	5.4	0.957	Contact Map
3qe7A	2	0.6733	4.7	0.958	Contact Map
1pw4A	1	0.5347	3.3	0.962	Contact Map
3ne5A	3	0.7822	2.7	0.963	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.