Q7LXR5 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXR5 - Methionyl-tRNA synthetase N-term homolog (MetS-like)

UniProt:	Q7LXR5	Sequences: MVFPSEILLTSITTILHNRYKKLASNKYKLLLHYVNQNPYNSSPMLNIMSNQITIDDFAKLDLKVGIVRQAERIEGTRLLKLLIDLGSEQRQIIAGLGEYYTPEELLNKRIIVIANLKPRVIRGFESQGMLLAAGCKEDEAKGIKPRILTVDGEVPPGTKIC	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	162 (143)
Sequences:	2652 (1934)
Seq/√Len:	161.8

ECOLI - YGJH SYM
BACSU - CSAA SYM
HALSA - SYM
SULSO - Q7LXR5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
73_R	98_G	3.582	1.00
70_Q	83_L	3.436	1.00
77_T	123_R	3.321	1.00
67_I	110_R	3.218	1.00
102_T	105_E	3.145	1.00
72_E	81_K	2.696	1.00
63_L	112_I	2.546	1.00
93_I	113_V	2.524	1.00
70_Q	107_L	2.515	1.00
57_D	60_K	2.471	1.00
93_I	129_G	2.405	1.00
136_C	145_K	2.104	1.00
66_G	84_I	2.087	1.00
83_L	92_Q	2.072	1.00
81_K	92_Q	2.062	1.00
69_R	90_Q	1.962	1.00
74_I	81_K	1.950	1.00
94_I	125_F	1.941	1.00
94_I	122_I	1.936	1.00
67_I	157_P	1.887	1.00
26_N	30_L	1.871	1.00
82_L	133_A	1.867	1.00
92_Q	125_F	1.860	1.00
68_V	111_I	1.850	1.00
61_L	114_I	1.723	1.00
62_D	160_K	1.694	1.00
52_Q	118_K	1.617	1.00
86_L	113_V	1.568	1.00
64_K	115_A	1.557	1.00
54_T	57_D	1.555	1.00
66_G	113_V	1.547	1.00
83_L	90_Q	1.512	1.00
19_R	22_K	1.504	1.00
110_R	154_E	1.500	1.00
109_K	150_T	1.470	1.00
121_V	126_E	1.455	1.00
25_S	28_Y	1.391	1.00
67_I	85_D	1.369	1.00
28_Y	32_L	1.367	1.00
138_E	145_K	1.364	1.00
17_H	21_K	1.353	1.00
82_L	131_L	1.351	1.00
80_L	103_P	1.330	1.00
26_N	29_K	1.282	1.00
112_I	149_L	1.273	1.00
85_D	157_P	1.263	1.00
89_E	128_Q	1.263	1.00
29_K	32_L	1.234	1.00
81_K	125_F	1.218	1.00
19_R	23_L	1.196	1.00
63_L	114_I	1.195	1.00
22_K	25_S	1.139	1.00
86_L	89_E	1.135	1.00
95_A	133_A	1.127	1.00
28_Y	31_L	1.121	1.00
94_I	120_R	1.107	1.00
50_S	160_K	1.105	1.00
71_A	82_L	1.105	1.00
17_H	20_Y	1.101	1.00
20_Y	23_L	1.078	0.99
137_K	145_K	1.071	0.99
69_R	85_D	1.064	0.99
73_R	103_P	1.063	0.99
71_A	103_P	1.058	0.99
84_I	93_I	1.056	0.99
13_T	19_R	1.047	0.99
133_A	148_I	1.046	0.99
134_A	155_V	1.043	0.99
111_I	131_L	1.029	0.99
80_L	98_G	1.012	0.99
13_T	18_N	1.003	0.99
65_V	110_R	0.999	0.99
18_N	24_A	0.990	0.99
74_I	125_F	0.984	0.99
54_T	118_K	0.979	0.99
84_I	131_L	0.968	0.99
30_L	34_Y	0.957	0.99
100_Y	146_P	0.955	0.99
13_T	17_H	0.949	0.99
110_R	157_P	0.949	0.99
25_S	29_K	0.937	0.99
73_R	102_T	0.929	0.98
17_H	22_K	0.928	0.98
72_E	83_L	0.921	0.98
16_L	19_R	0.913	0.98
53_I	61_L	0.893	0.98
55_I	59_A	0.889	0.98
109_K	152_D	0.883	0.98
17_H	23_L	0.877	0.98
93_I	131_L	0.874	0.98
25_S	32_L	0.871	0.98
82_L	95_A	0.864	0.97
82_L	106_L	0.857	0.97
76_G	123_R	0.849	0.97
48_I	51_N	0.847	0.97
30_L	33_H	0.826	0.97
21_K	24_A	0.826	0.97
102_T	106_L	0.823	0.97
71_A	95_A	0.820	0.97
84_I	111_I	0.813	0.96
71_A	80_L	0.807	0.96
150_T	153_G	0.797	0.96
112_I	151_V	0.794	0.96
86_L	115_A	0.793	0.96
32_L	35_V	0.792	0.96
74_I	77_T	0.790	0.96
29_K	33_H	0.785	0.96
85_D	90_Q	0.782	0.95
31_L	35_V	0.781	0.95
66_G	90_Q	0.780	0.95
77_T	98_G	0.776	0.95
112_I	161_I	0.773	0.95
16_L	20_Y	0.765	0.95
56_D	59_A	0.765	0.95
16_L	22_K	0.764	0.95
84_I	113_V	0.755	0.95
117_L	130_M	0.752	0.94
32_L	36_N	0.749	0.94
66_G	93_I	0.727	0.93
151_V	155_V	0.724	0.93
149_L	152_D	0.717	0.93
86_L	90_Q	0.712	0.93
34_Y	38_N	0.707	0.92
49_M	62_D	0.704	0.92
15_I	19_R	0.703	0.92
18_N	21_K	0.701	0.92
147_R	154_E	0.699	0.92
35_V	38_N	0.696	0.92
40_Y	44_P	0.696	0.92
20_Y	24_A	0.692	0.92
98_G	102_T	0.690	0.91
17_H	25_S	0.687	0.91
41_N	44_P	0.683	0.91
49_M	88_S	0.681	0.91
147_R	153_G	0.679	0.91
75_E	81_K	0.672	0.90
27_K	31_L	0.663	0.90
65_V	161_I	0.663	0.90
100_Y	145_K	0.658	0.89
49_M	52_Q	0.656	0.89
147_R	151_V	0.652	0.89
113_V	131_L	0.652	0.89
65_V	112_I	0.651	0.89
16_L	21_K	0.650	0.89
46_L	49_M	0.647	0.89
38_N	42_S	0.647	0.89
131_L	148_I	0.644	0.88
91_R	128_Q	0.642	0.88
68_V	71_A	0.637	0.88
147_R	152_D	0.636	0.88
106_L	148_I	0.632	0.87
147_R	155_V	0.632	0.87
23_L	27_K	0.632	0.87
96_G	122_I	0.625	0.87
38_N	41_N	0.621	0.87
53_I	114_I	0.618	0.86
19_R	24_A	0.616	0.86
74_I	123_R	0.616	0.86
147_R	150_T	0.611	0.86
156_P	159_T	0.608	0.85
63_L	132_L	0.608	0.85
20_Y	25_S	0.606	0.85
57_D	61_L	0.589	0.84
64_K	160_K	0.586	0.83
50_S	59_A	0.584	0.83
109_K	148_I	0.580	0.83
94_I	123_R	0.579	0.83
41_N	45_M	0.578	0.82
110_R	156_P	0.568	0.81
100_Y	135_G	0.564	0.81
98_G	123_R	0.564	0.81
103_P	106_L	0.562	0.81
24_A	29_K	0.562	0.81
24_A	28_Y	0.562	0.81
49_M	115_A	0.555	0.80
68_V	148_I	0.551	0.79
23_L	26_N	0.550	0.79
31_L	36_N	0.549	0.79
111_I	148_I	0.548	0.79
21_K	25_S	0.547	0.79
122_I	129_G	0.546	0.79
135_G	146_P	0.543	0.78
48_I	88_S	0.538	0.78
75_E	123_R	0.537	0.78
15_I	18_N	0.537	0.78
33_H	36_N	0.535	0.77
97_L	146_P	0.534	0.77
15_I	23_L	0.533	0.77
35_V	39_P	0.527	0.76
73_R	77_T	0.525	0.76
155_V	159_T	0.522	0.76
99_E	138_E	0.521	0.75
18_N	22_K	0.520	0.75
20_Y	28_Y	0.519	0.75
104_E	107_L	0.517	0.75
27_K	30_L	0.515	0.75
39_P	43_S	0.514	0.75
22_K	26_N	0.512	0.74
85_D	88_S	0.512	0.74
80_L	97_L	0.512	0.74
24_A	27_K	0.512	0.74
68_V	131_L	0.511	0.74
98_G	103_P	0.509	0.74
110_R	159_T	0.507	0.74
132_L	146_P	0.507	0.74
13_T	23_L	0.506	0.73
95_A	131_L	0.505	0.73
71_A	133_A	0.504	0.73
76_G	124_G	0.504	0.73
65_V	151_V	0.503	0.73
15_I	20_Y	0.503	0.73
15_I	21_K	0.500	0.73
55_I	120_R	0.500	0.73
70_Q	81_K	0.500	0.73

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1rqgA	2	0.2531	100	0.355	Contact Map
3ersX	2	0.6728	100	0.38	Contact Map
4r3zA	1	0.179	100	0.382	Contact Map
1pybA	2	0.6543	100	0.382	Contact Map
1mkhA	2	0.6481	100	0.385	Contact Map
2cwpA	2	0.6667	100	0.388	Contact Map
1gd7A	2	0.6543	100	0.389	Contact Map
3g48A	2	0.6605	100	0.391	Contact Map
2q2hA	2	0.7099	100	0.393	Contact Map
2q2iA	2	0.6667	100	0.394	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.