Q7LXQ9 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXQ9 - Uncharacterized protein

UniProt:	Q7LXQ9	Sequences: MLVEKIKGYLNSISGVLQERFENRERVLMLARELIRYCGETISLSHKGKKEEALKKYQIAISKVSEIQKIIDSFPELLYGDVGTAYQELAEASIVISLYFDVELKLSKELGIPDIYYISGIADAIGEMRRRVLELLKKNKIDEAENTYNIMEELYELLWSFEYPKSLVPGLRQKIDTIRRLLEETNHDIFLAKLGRS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	197 (185)
Sequences:	647 (481)
Seq/√Len:	35.3

SULSO - Q7LXQ9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
151_M	185_T	4.936	1.00
42_I	47_K	3.345	1.00
94_I	105_K	3.006	1.00
43_S	47_K	2.911	1.00
140_K	143_E	2.836	1.00
88_E	91_E	2.810	1.00
172_R	176_D	2.642	1.00
34_L	67_I	2.583	1.00
34_L	64_V	2.533	1.00
94_I	124_A	2.453	1.00
54_L	100_F	2.348	0.99
125_I	154_L	2.336	0.99
185_T	192_A	2.259	0.99
54_L	58_Q	2.209	0.99
119_S	170_G	2.208	0.99
42_I	46_H	2.130	0.99
165_K	172_R	2.117	0.99
123_D	126_G	2.092	0.99
123_D	174_K	1.967	0.98
133_L	188_D	1.954	0.98
119_S	123_D	1.876	0.97
24_R	28_L	1.840	0.97
91_E	123_D	1.826	0.97
15_G	19_E	1.790	0.97
88_E	126_G	1.745	0.96
39_G	43_S	1.732	0.96
36_R	40_E	1.709	0.95
97_S	101_D	1.678	0.95
126_G	181_L	1.676	0.95
143_E	146_N	1.668	0.95
122_A	178_I	1.651	0.95
161_F	171_L	1.648	0.94
107_S	111_G	1.643	0.94
58_Q	62_S	1.632	0.94
88_E	123_D	1.627	0.94
116_Y	150_I	1.602	0.94
75_P	80_G	1.595	0.93
41_T	57_Y	1.593	0.93
25_E	32_R	1.571	0.93
38_C	42_I	1.518	0.92
62_S	66_E	1.498	0.91
63_K	66_E	1.451	0.90
29_M	33_E	1.446	0.89
118_I	173_Q	1.399	0.88
104_L	121_I	1.376	0.87
186_N	190_F	1.357	0.86
136_L	144_A	1.357	0.86
30_L	66_E	1.346	0.86
26_R	70_I	1.341	0.86
84_T	189_I	1.315	0.84
45_S	99_Y	1.312	0.84
95_V	131_R	1.301	0.84
88_E	92_A	1.294	0.83
84_T	87_Q	1.272	0.82
39_G	42_I	1.268	0.82
91_E	126_G	1.267	0.82
176_D	179_R	1.257	0.82
14_S	18_Q	1.252	0.81
136_L	183_E	1.244	0.81
87_Q	119_S	1.228	0.80
165_K	176_D	1.226	0.80
20_R	76_E	1.202	0.79
116_Y	186_N	1.198	0.78
175_I	178_I	1.187	0.78
90_A	94_I	1.182	0.77
151_M	179_R	1.181	0.77
42_I	92_A	1.174	0.77
72_D	75_P	1.169	0.77
95_V	124_A	1.137	0.75
93_S	97_S	1.122	0.74
118_I	156_E	1.122	0.74
87_Q	174_K	1.113	0.73
91_E	129_R	1.100	0.72
59_I	62_S	1.086	0.71
126_G	174_K	1.086	0.71
107_S	112_I	1.086	0.71
181_L	184_E	1.081	0.71
108_K	111_G	1.079	0.71
35_I	39_G	1.076	0.70
172_R	179_R	1.070	0.70
48_G	66_E	1.069	0.70
142_D	192_A	1.065	0.70
29_M	123_D	1.062	0.69
60_A	140_K	1.054	0.69
164_P	183_E	1.048	0.68
35_I	85_A	1.046	0.68
176_D	187_H	1.042	0.68
23_N	74_F	1.035	0.67
17_L	139_N	1.030	0.67
104_L	117_Y	1.022	0.66
177_T	180_R	1.016	0.66
18_Q	22_E	1.015	0.66
118_I	166_S	1.010	0.65
165_K	180_R	1.007	0.65
127_E	130_R	1.005	0.65
96_I	100_F	0.999	0.65
91_E	124_A	0.997	0.64
32_R	88_E	0.995	0.64
81_D	125_I	0.985	0.63
84_T	133_L	0.984	0.63
162_E	166_S	0.976	0.63
118_I	171_L	0.973	0.62
51_E	58_Q	0.971	0.62
118_I	165_K	0.960	0.61
125_I	178_I	0.953	0.61
163_Y	179_R	0.945	0.60
35_I	42_I	0.944	0.60
126_G	177_T	0.941	0.60
147_T	153_E	0.918	0.58
190_F	195_G	0.911	0.57
26_R	73_S	0.910	0.57
62_S	111_G	0.899	0.56
39_G	186_N	0.894	0.56
38_C	92_A	0.892	0.56
40_E	43_S	0.892	0.56
115_I	172_R	0.890	0.56
133_L	184_E	0.889	0.55
88_E	174_K	0.888	0.55
101_D	135_L	0.886	0.55
32_R	35_I	0.884	0.55
164_P	172_R	0.880	0.55
134_E	137_K	0.876	0.54
51_E	55_K	0.874	0.54
28_L	39_G	0.874	0.54
98_L	121_I	0.868	0.54
15_G	69_K	0.865	0.53
64_V	86_Y	0.864	0.53
55_K	59_I	0.862	0.53
52_E	56_K	0.861	0.53
137_K	186_N	0.859	0.53
102_V	146_N	0.857	0.53
22_E	33_E	0.850	0.52
132_V	147_T	0.849	0.52
61_I	89_L	0.847	0.52
176_D	180_R	0.839	0.51
27_V	184_E	0.836	0.51
164_P	179_R	0.835	0.51
165_K	183_E	0.832	0.51
174_K	182_L	0.825	0.50
37_Y	63_K	0.813	0.49
90_A	122_A	0.810	0.49
27_V	67_I	0.807	0.48
32_R	91_E	0.807	0.48
48_G	62_S	0.806	0.48
170_G	173_Q	0.806	0.48
119_S	125_I	0.806	0.48
180_R	183_E	0.804	0.48
61_I	65_S	0.790	0.47
30_L	63_K	0.787	0.47
129_R	181_L	0.780	0.46
136_L	191_L	0.779	0.46
31_A	35_I	0.775	0.46
43_S	46_H	0.768	0.45
177_T	181_L	0.765	0.45
87_Q	188_D	0.764	0.45
179_R	183_E	0.758	0.44
34_L	102_V	0.756	0.44
97_S	103_E	0.753	0.44
92_A	126_G	0.749	0.43
54_L	106_L	0.749	0.43
25_E	98_L	0.747	0.43
39_G	45_S	0.744	0.43
132_V	186_N	0.741	0.43
22_E	184_E	0.729	0.42
14_S	19_E	0.727	0.42
18_Q	106_L	0.727	0.42
138_K	146_N	0.727	0.42
99_Y	137_K	0.724	0.41
65_S	103_E	0.724	0.41
50_K	158_L	0.717	0.41
163_Y	176_D	0.716	0.41
50_K	53_A	0.715	0.41
105_K	110_L	0.714	0.41
112_I	154_L	0.713	0.40
42_I	123_D	0.710	0.40
108_K	115_I	0.702	0.40
17_L	21_F	0.698	0.39
17_L	68_Q	0.695	0.39
188_D	191_L	0.691	0.39
136_L	139_N	0.690	0.39
166_S	180_R	0.689	0.38
36_R	78_L	0.688	0.38
42_I	88_E	0.681	0.38
29_M	119_S	0.681	0.38
138_K	157_L	0.681	0.38
28_L	81_D	0.678	0.38
145_E	149_N	0.674	0.37
163_Y	172_R	0.674	0.37
18_Q	113_P	0.674	0.37
8_G	11_N	0.674	0.37
135_L	140_K	0.670	0.37
120_G	178_I	0.665	0.37
55_K	69_K	0.661	0.36
22_E	103_E	0.659	0.36
67_I	99_Y	0.656	0.36
86_Y	113_P	0.647	0.35
179_R	187_H	0.642	0.35
166_S	170_G	0.641	0.35
164_P	191_L	0.641	0.35
173_Q	176_D	0.639	0.34
56_K	59_I	0.634	0.34
99_Y	190_F	0.633	0.34
17_L	126_G	0.632	0.34
133_L	187_H	0.632	0.34
63_K	89_L	0.630	0.34
94_I	120_G	0.630	0.34
70_I	185_T	0.629	0.34
43_S	133_L	0.625	0.33
136_L	162_E	0.621	0.33
76_E	150_I	0.621	0.33
162_E	171_L	0.617	0.33
161_F	176_D	0.617	0.33
91_E	127_E	0.613	0.32
88_E	120_G	0.612	0.32
162_E	176_D	0.612	0.32
189_I	193_K	0.611	0.32
58_Q	61_I	0.611	0.32
24_R	32_R	0.610	0.32
162_E	165_K	0.607	0.32
154_L	161_F	0.607	0.32
163_Y	166_S	0.605	0.32
26_R	170_G	0.605	0.32
41_T	60_A	0.604	0.32
89_L	102_V	0.602	0.32
92_A	121_I	0.592	0.31
12_S	27_V	0.588	0.31
162_E	172_R	0.586	0.30
187_H	191_L	0.583	0.30
96_I	101_D	0.582	0.30
12_S	62_S	0.580	0.30
69_K	153_E	0.577	0.30
77_L	89_L	0.576	0.30
162_E	187_H	0.575	0.30
45_S	95_V	0.575	0.30
40_E	173_Q	0.572	0.29
93_S	110_L	0.571	0.29
106_L	128_M	0.567	0.29
137_K	166_S	0.567	0.29
82_V	147_T	0.562	0.29
19_E	53_A	0.561	0.29
87_Q	123_D	0.561	0.29
191_L	194_L	0.560	0.29
48_G	51_E	0.555	0.28
162_E	188_D	0.555	0.28
75_P	78_L	0.554	0.28
14_S	131_R	0.552	0.28
99_Y	184_E	0.552	0.28
20_R	74_F	0.551	0.28
22_E	98_L	0.551	0.28
80_G	152_E	0.547	0.28
115_I	164_P	0.546	0.28
94_I	106_L	0.545	0.28
62_S	65_S	0.542	0.27
134_E	172_R	0.542	0.27
52_E	149_N	0.541	0.27
126_G	184_E	0.540	0.27
115_I	173_Q	0.540	0.27
46_H	126_G	0.538	0.27
26_R	85_A	0.534	0.27
55_K	103_E	0.529	0.26
13_I	146_N	0.527	0.26
119_S	175_I	0.527	0.26
13_I	97_S	0.526	0.26
53_A	58_Q	0.524	0.26
98_L	116_Y	0.521	0.26
19_E	178_I	0.521	0.26
151_M	188_D	0.517	0.26
11_N	51_E	0.513	0.25
118_I	131_R	0.511	0.25
65_S	69_K	0.507	0.25
181_L	186_N	0.507	0.25
39_G	184_E	0.507	0.25
21_F	25_E	0.507	0.25
147_T	185_T	0.505	0.25
122_A	177_T	0.504	0.25
45_S	132_V	0.501	0.25
44_L	105_K	0.501	0.25
85_A	126_G	0.500	0.25

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3axjA	1	0.9848	100	0.066	Contact Map
3qb5K	2	0.9848	100	0.067	Contact Map
3axjB	1	0.9898	100	0.073	Contact Map
1j1jA	4	0.9645	100	0.093	Contact Map
3zc0A	5	0.9543	100	0.127	Contact Map
4nadB	2	0.3858	25.1	0.947	Contact Map
4aurA	1	0.3452	21.7	0.948	Contact Map
4flaA	2	0.3756	20	0.949	Contact Map
3wscA	2	0.9137	17.4	0.951	Contact Map
4glxA	1	0.6142	14.8	0.952	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.