Q7LXQ7 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXQ7 - Uncharacterized protein

UniProt:	Q7LXQ7	Sequences: MEVLKRVDKQDVLKGEVEELVKQIEQDDLKVVTFMEYTNPPEKVKPKLIKFEKVLPLLERIAESGKIQNGVAKIMFFSPSTCRNRGLTPTMMAGFQLIKPGIATKPHSHNMASIYLVFRGRGYSVIGKEKIEWKAGDVFVVPANEIHYHVNTGDDDCILFDVTDSGLLESLGILEFRE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	178 (153)
Sequences:	1100 (653)
Seq/√Len:	52.8

SULSO - Q7LXQ7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
124_S	149_H	4.889	1.00
55_L	119_R	3.224	1.00
123_Y	130_K	3.004	1.00
133_W	149_H	2.995	1.00
133_W	157_C	2.751	1.00
34_F	37_Y	2.520	1.00
124_S	133_W	2.499	1.00
50_K	53_K	2.469	1.00
167_L	171_L	2.441	1.00
121_R	155_D	2.350	1.00
127_G	145_E	2.306	1.00
107_H	147_H	2.305	1.00
60_R	63_E	2.245	1.00
23_Q	60_R	2.191	1.00
125_V	128_K	2.122	1.00
121_R	134_K	2.049	1.00
45_K	48_L	2.022	1.00
22_K	25_E	2.002	1.00
28_D	31_V	1.929	1.00
25_E	28_D	1.756	0.99
100_P	151_N	1.728	0.99
87_L	93_A	1.717	0.99
28_D	32_V	1.686	0.99
123_Y	150_V	1.668	0.99
27_D	31_V	1.655	0.98
109_H	147_H	1.654	0.98
61_I	64_S	1.620	0.98
126_I	131_I	1.536	0.97
27_D	32_V	1.523	0.97
33_T	36_E	1.515	0.97
53_K	56_P	1.474	0.97
115_Y	141_V	1.468	0.97
54_V	95_F	1.438	0.96
27_D	30_K	1.430	0.96
55_L	59_E	1.416	0.96
62_A	67_I	1.357	0.95
125_V	148_Y	1.336	0.94
74_I	94_G	1.333	0.94
133_W	139_F	1.333	0.94
113_S	161_D	1.328	0.94
151_N	155_D	1.268	0.93
25_E	29_L	1.248	0.92
25_E	30_K	1.247	0.92
51_F	158_I	1.244	0.92
127_G	146_I	1.235	0.92
119_R	155_D	1.233	0.92
109_H	113_S	1.227	0.91
58_L	97_L	1.219	0.91
103_A	150_V	1.214	0.91
151_N	156_D	1.214	0.91
123_Y	132_E	1.210	0.91
106_P	146_I	1.205	0.91
33_T	37_Y	1.202	0.91
113_S	163_T	1.193	0.90
115_Y	161_D	1.180	0.90
73_K	96_Q	1.147	0.88
108_S	144_N	1.130	0.88
33_T	38_T	1.120	0.87
130_K	150_V	1.105	0.86
168_L	173_I	1.097	0.86
122_G	133_W	1.094	0.86
109_H	149_H	1.077	0.85
79_P	137_D	1.073	0.85
118_F	158_I	1.060	0.84
130_K	149_H	1.056	0.84
111_M	174_L	1.052	0.84
101_G	122_G	1.048	0.83
94_G	161_D	1.045	0.83
37_Y	174_L	1.031	0.82
59_E	63_E	1.028	0.82
97_L	158_I	1.026	0.82
132_E	152_T	1.025	0.82
74_I	117_V	1.014	0.81
105_K	123_Y	1.008	0.81
107_H	113_S	1.003	0.80
116_L	138_V	0.999	0.80
115_Y	159_L	0.996	0.80
119_R	124_S	0.995	0.80
107_H	149_H	0.979	0.79
141_V	147_H	0.978	0.79
146_I	149_H	0.977	0.79
98_I	132_E	0.977	0.79
29_L	32_V	0.976	0.79
98_I	151_N	0.975	0.79
149_H	157_C	0.960	0.77
88_T	93_A	0.958	0.77
73_K	94_G	0.951	0.77
110_N	144_N	0.951	0.77
54_V	58_L	0.943	0.76
59_E	62_A	0.942	0.76
96_Q	115_Y	0.939	0.76
106_P	148_Y	0.937	0.76
23_Q	26_Q	0.936	0.76
95_F	158_I	0.923	0.75
23_Q	28_D	0.921	0.74
51_F	55_L	0.917	0.74
89_P	122_G	0.911	0.74
51_F	119_R	0.909	0.73
107_H	115_Y	0.894	0.72
26_Q	30_K	0.875	0.71
35_M	166_G	0.873	0.70
55_L	158_I	0.868	0.70
139_F	157_C	0.864	0.70
24_I	28_D	0.861	0.69
119_R	135_A	0.860	0.69
58_L	158_I	0.858	0.69
28_D	117_V	0.855	0.69
99_K	102_I	0.854	0.69
36_E	111_M	0.852	0.69
92_M	166_G	0.849	0.68
72_A	102_I	0.838	0.67
96_Q	161_D	0.836	0.67
125_V	130_K	0.835	0.67
43_K	60_R	0.829	0.66
125_V	150_V	0.827	0.66
98_I	114_I	0.826	0.66
113_S	147_H	0.823	0.66
35_M	80_S	0.817	0.65
67_I	72_A	0.807	0.64
50_K	154_D	0.804	0.64
96_Q	159_L	0.799	0.64
91_M	162_V	0.789	0.63
111_M	165_S	0.787	0.62
103_A	155_D	0.786	0.62
49_I	159_L	0.781	0.62
45_K	80_S	0.780	0.62
103_A	148_Y	0.768	0.60
62_A	97_L	0.767	0.60
76_F	85_R	0.764	0.60
120_G	137_D	0.763	0.60
30_K	76_F	0.759	0.60
113_S	146_I	0.759	0.60
123_Y	152_T	0.753	0.59
86_G	169_E	0.752	0.59
99_K	156_D	0.749	0.59
93_A	162_V	0.745	0.58
51_F	95_F	0.744	0.58
96_Q	149_H	0.744	0.58
51_F	54_V	0.743	0.58
59_E	156_D	0.741	0.58
144_N	175_E	0.739	0.58
124_S	139_F	0.733	0.57
81_T	85_R	0.728	0.56
31_V	34_F	0.728	0.56
167_L	172_G	0.724	0.56
131_I	145_E	0.724	0.56
121_R	154_D	0.718	0.55
66_K	69_N	0.714	0.55
26_Q	29_L	0.710	0.55
110_N	168_L	0.708	0.54
115_Y	140_V	0.704	0.54
109_H	124_S	0.697	0.53
82_C	160_F	0.692	0.53
121_R	152_T	0.684	0.52
112_A	120_G	0.679	0.51
89_P	172_G	0.677	0.51
73_K	161_D	0.670	0.50
115_Y	139_F	0.670	0.50
22_K	27_D	0.668	0.50
98_I	155_D	0.665	0.50
98_I	153_G	0.664	0.50
115_Y	147_H	0.663	0.50
24_I	27_D	0.659	0.49
40_P	46_P	0.654	0.49
87_L	143_A	0.653	0.49
22_K	39_N	0.652	0.48
124_S	157_C	0.648	0.48
64_S	126_I	0.647	0.48
128_K	147_H	0.643	0.47
57_L	60_R	0.634	0.47
87_L	110_N	0.631	0.46
35_M	38_T	0.630	0.46
25_E	82_C	0.622	0.45
70_G	75_M	0.619	0.45
130_K	152_T	0.612	0.44
30_K	34_F	0.610	0.44
23_Q	27_D	0.610	0.44
90_T	160_F	0.607	0.44
22_K	26_Q	0.607	0.44
133_W	147_H	0.605	0.44
129_E	132_E	0.605	0.44
70_G	161_D	0.603	0.43
57_L	171_L	0.603	0.43
126_I	145_E	0.593	0.42
76_F	160_F	0.590	0.42
121_R	135_A	0.590	0.42
117_V	139_F	0.589	0.42
111_M	143_A	0.586	0.42
38_T	41_P	0.584	0.41
78_S	116_L	0.582	0.41
94_G	102_I	0.582	0.41
22_K	30_K	0.581	0.41
115_Y	126_I	0.581	0.41
97_L	156_D	0.575	0.40
40_P	91_M	0.575	0.40
58_L	162_V	0.573	0.40
66_K	80_S	0.571	0.40
56_P	60_R	0.569	0.40
116_L	136_G	0.569	0.40
104_T	163_T	0.568	0.40
82_C	90_T	0.568	0.40
57_L	86_G	0.568	0.40
109_H	163_T	0.558	0.39
24_I	30_K	0.556	0.39
87_L	111_M	0.553	0.38
115_Y	163_T	0.551	0.38
58_L	159_L	0.550	0.38
107_H	163_T	0.550	0.38
93_A	164_D	0.548	0.38
112_A	168_L	0.548	0.38
123_Y	148_Y	0.544	0.37
87_L	94_G	0.540	0.37
71_V	86_G	0.540	0.37
49_I	78_S	0.539	0.37
23_Q	154_D	0.529	0.36
43_K	52_E	0.527	0.36
137_D	166_G	0.526	0.36
124_S	147_H	0.526	0.36
112_A	145_E	0.524	0.35
93_A	144_N	0.520	0.35
61_I	124_S	0.519	0.35
125_V	152_T	0.518	0.35
104_T	159_L	0.515	0.35
167_L	170_S	0.508	0.34
63_E	153_G	0.505	0.34
113_S	141_V	0.503	0.33
122_G	157_C	0.502	0.33
69_N	98_I	0.502	0.33
58_L	95_F	0.501	0.33
41_P	52_E	0.500	0.33

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3nw4A	3	0.9888	100	0.498	Contact Map
2d40A	3	0.7135	99.9	0.518	Contact Map
3bu7A	3	0.9494	99.9	0.536	Contact Map
2vqaA	3	0.7528	99.4	0.727	Contact Map
1j58A	5	0.927	99.3	0.737	Contact Map
3jzvA	5	0.7303	99.3	0.744	Contact Map
3ibmA	2	0.7191	99.2	0.754	Contact Map
2d5fA	5	0.6798	98.9	0.777	Contact Map
1dgwA	3	0.7135	98.9	0.778	Contact Map
1uijA	3	0.736	98.9	0.778	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.