Q7LXQ4 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXQ4 - Uncharacterized protein

UniProt:	Q7LXQ4	Sequences: MMSIKIDVVRIDIPEGTNVIIGQSHFIKTVEDLYETLSSSSPNLKFGIAFNEASSKRLIRYDGNDQELIKLAIENAKKIGAGHVFVIYLKNGYPINVLNRIKNVEEVVRIFVATANPLQVIVAETDQGRGVIGVVDGYAPLGVESEADIQERKEFLRKIGYKR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	163 (159)
Sequences:	242 (167)
Seq/√Len:	13.3

SULSO - Q7LXQ4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
57_R	141_L	5.769	1.00
34_Y	62_D	3.647	0.99
24_S	29_T	3.166	0.98
155_F	159_I	3.060	0.97
112_V	118_L	2.962	0.97
84_V	131_V	2.806	0.95
12_D	74_E	2.711	0.94
59_I	77_K	2.626	0.93
6_I	132_I	2.589	0.93
121_I	132_I	2.567	0.92
51_N	76_A	2.488	0.91
37_L	44_L	2.389	0.89
125_T	135_V	2.317	0.88
33_L	87_I	2.174	0.84
124_E	129_R	2.123	0.83
80_G	140_P	2.095	0.82
99_N	102_K	2.022	0.79
44_L	92_G	2.017	0.79
39_S	105_E	1.996	0.78
57_R	138_Y	1.945	0.76
119_Q	127_Q	1.891	0.74
33_L	101_I	1.879	0.74
23_Q	111_F	1.866	0.73
45_K	65_D	1.838	0.72
128_G	135_V	1.830	0.72
41_S	64_N	1.807	0.71
10_R	119_Q	1.793	0.70
64_N	92_G	1.779	0.70
36_T	104_V	1.769	0.69
150_Q	154_E	1.711	0.66
145_S	148_D	1.595	0.61
7_D	122_V	1.589	0.60
56_K	151_E	1.575	0.60
125_T	128_G	1.575	0.60
11_I	19_V	1.562	0.59
37_L	40_S	1.525	0.57
154_E	158_K	1.511	0.56
13_I	17_T	1.481	0.55
87_I	101_I	1.464	0.54
73_I	143_V	1.462	0.54
71_L	88_Y	1.449	0.53
61_Y	149_I	1.443	0.53
4_I	75_N	1.433	0.52
13_I	16_G	1.430	0.52
119_Q	125_T	1.425	0.52
61_Y	69_I	1.410	0.51
19_V	88_Y	1.371	0.49
21_I	101_I	1.361	0.49
21_I	86_V	1.358	0.48
67_E	90_K	1.354	0.48
119_Q	128_G	1.341	0.48
130_G	135_V	1.336	0.47
21_I	120_V	1.305	0.46
56_K	148_D	1.301	0.45
48_I	87_I	1.282	0.44
11_I	79_I	1.268	0.44
43_N	64_N	1.266	0.44
61_Y	73_I	1.262	0.43
21_I	131_V	1.201	0.40
51_N	130_G	1.193	0.40
56_K	141_L	1.182	0.39
41_S	44_L	1.164	0.38
37_L	97_V	1.162	0.38
11_I	86_V	1.141	0.37
15_E	45_K	1.123	0.36
121_I	135_V	1.100	0.35
40_S	97_V	1.098	0.35
126_D	139_A	1.097	0.35
79_I	140_P	1.082	0.34
19_V	118_L	1.074	0.34
22_G	85_F	1.055	0.33
59_I	93_Y	1.029	0.32
34_Y	46_F	1.027	0.32
93_Y	159_I	1.011	0.31
16_G	64_N	1.010	0.31
59_I	70_K	1.008	0.31
157_R	162_K	1.000	0.31
40_S	105_E	0.993	0.30
17_T	89_L	0.989	0.30
51_N	84_V	0.983	0.30
17_T	71_L	0.958	0.29
64_N	68_L	0.957	0.29
31_E	35_E	0.956	0.29
112_V	119_Q	0.949	0.28
10_R	78_K	0.937	0.28
62_D	84_V	0.923	0.27
98_L	110_I	0.915	0.27
67_E	103_N	0.904	0.26
112_V	130_G	0.898	0.26
45_K	91_N	0.866	0.25
12_D	110_I	0.860	0.25
48_I	66_Q	0.859	0.25
98_L	102_K	0.857	0.25
35_E	157_R	0.855	0.25
25_H	35_E	0.851	0.24
74_E	78_K	0.851	0.24
45_K	155_F	0.840	0.24
18_N	25_H	0.839	0.24
51_N	149_I	0.835	0.24
86_V	122_V	0.834	0.24
8_V	121_I	0.834	0.24
80_G	155_F	0.825	0.23
13_I	71_L	0.824	0.23
13_I	75_N	0.814	0.23
151_E	155_F	0.809	0.23
73_I	77_K	0.808	0.23
138_Y	141_L	0.789	0.22
67_E	111_F	0.778	0.22
122_V	143_V	0.771	0.21
96_N	129_R	0.771	0.21
50_F	54_S	0.770	0.21
28_K	156_L	0.768	0.21
111_F	121_I	0.761	0.21
98_L	108_V	0.756	0.21
51_N	81_A	0.750	0.21
42_P	97_V	0.746	0.21
11_I	21_I	0.742	0.20
41_S	92_G	0.740	0.20
78_K	118_L	0.739	0.20
45_K	90_K	0.739	0.20
12_D	139_A	0.735	0.20
30_V	62_D	0.728	0.20
33_L	64_N	0.727	0.20
37_L	101_I	0.724	0.20
124_E	139_A	0.721	0.20
80_G	145_S	0.711	0.19
13_I	34_Y	0.709	0.19
35_E	106_E	0.706	0.19
57_R	140_P	0.706	0.19
40_S	48_I	0.704	0.19
35_E	162_K	0.690	0.19
57_R	108_V	0.686	0.19
25_H	106_E	0.682	0.18
68_L	149_I	0.678	0.18
109_R	118_L	0.677	0.18
24_S	147_A	0.671	0.18
39_S	143_V	0.667	0.18
41_S	97_V	0.665	0.18
23_Q	108_V	0.664	0.18
144_E	152_R	0.664	0.18
50_F	106_E	0.658	0.18
81_A	122_V	0.658	0.18
107_V	155_F	0.657	0.18
25_H	50_F	0.655	0.18
42_P	87_I	0.646	0.17
40_S	72_A	0.645	0.17
39_S	112_V	0.642	0.17
35_E	50_F	0.635	0.17
75_N	100_R	0.635	0.17
39_S	95_I	0.631	0.17
61_Y	126_D	0.628	0.17
4_I	7_D	0.628	0.17
118_L	122_V	0.628	0.17
4_I	79_I	0.625	0.17
36_T	129_R	0.623	0.17
54_S	106_E	0.622	0.17
74_E	150_Q	0.620	0.17
21_I	64_N	0.618	0.16
67_E	146_E	0.617	0.16
5_K	120_V	0.616	0.16
88_Y	143_V	0.616	0.16
53_A	132_I	0.616	0.16
17_T	88_Y	0.615	0.16
119_Q	135_V	0.611	0.16
35_E	54_S	0.607	0.16
5_K	124_E	0.607	0.16
43_N	111_F	0.603	0.16
111_F	151_E	0.602	0.16
55_S	89_L	0.600	0.16
101_I	107_V	0.599	0.16
53_A	56_K	0.599	0.16
44_L	64_N	0.596	0.16
39_S	155_F	0.592	0.16
9_V	110_I	0.590	0.16
13_I	88_Y	0.590	0.16
121_I	149_I	0.589	0.16
62_D	105_E	0.585	0.16
39_S	100_R	0.582	0.15
44_L	48_I	0.581	0.15
91_N	135_V	0.580	0.15
43_N	90_K	0.577	0.15
51_N	101_I	0.576	0.15
8_V	91_N	0.574	0.15
67_E	158_K	0.572	0.15
9_V	138_Y	0.571	0.15
121_I	139_A	0.569	0.15
142_G	156_L	0.567	0.15
122_V	158_K	0.566	0.15
75_N	88_Y	0.566	0.15
93_Y	145_S	0.561	0.15
34_Y	45_K	0.558	0.15
93_Y	120_V	0.558	0.15
44_L	155_F	0.554	0.15
93_Y	132_I	0.551	0.15
30_V	117_P	0.550	0.15
5_K	45_K	0.546	0.14
99_N	103_N	0.544	0.14
14_P	111_F	0.542	0.14
148_D	151_E	0.542	0.14
41_S	59_I	0.541	0.14
25_H	54_S	0.540	0.14
28_K	35_E	0.540	0.14
123_A	135_V	0.539	0.14
8_V	119_Q	0.538	0.14
7_D	11_I	0.537	0.14
42_P	111_F	0.537	0.14
33_L	100_R	0.535	0.14
109_R	155_F	0.534	0.14
72_A	153_K	0.534	0.14
12_D	91_N	0.534	0.14
18_N	106_E	0.532	0.14
95_I	108_V	0.531	0.14
119_Q	143_V	0.531	0.14
48_I	84_V	0.529	0.14
151_E	154_E	0.529	0.14
23_Q	84_V	0.528	0.14
132_I	135_V	0.528	0.14
36_T	59_I	0.526	0.14
31_E	50_F	0.526	0.14
37_L	151_E	0.525	0.14
7_D	74_E	0.525	0.14
66_Q	101_I	0.522	0.14
106_E	157_R	0.520	0.14
90_K	120_V	0.520	0.14
13_I	104_V	0.518	0.14
11_I	17_T	0.517	0.14
88_Y	104_V	0.517	0.14
71_L	105_E	0.516	0.14
11_I	88_Y	0.515	0.14
33_L	48_I	0.514	0.14
10_R	131_V	0.512	0.14
105_E	112_V	0.511	0.14
28_K	50_F	0.511	0.14
37_L	41_S	0.508	0.13
114_T	130_G	0.505	0.13
18_N	50_F	0.502	0.13
18_N	54_S	0.501	0.13
28_K	54_S	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ekmA	3	0.9816	100	0.023	Contact Map
1wvqA	4	0.9877	100	0.034	Contact Map
1vggA	5	0.9816	100	0.041	Contact Map
1rlhA	3	0.8896	100	0.044	Contact Map
2d16A	5	0.9816	100	0.053	Contact Map
1t7lA	1	0.9141	49.9	0.958	Contact Map
1u1jA	1	0.9264	32	0.963	Contact Map
1zjcA	2	0.7178	31.1	0.963	Contact Map
3qg2A	2	0.362	26.9	0.964	Contact Map
2nq5A	1	0.8098	20.7	0.966	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.