Q7LXP0 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXP0 - Iron-dependent repressor

UniProt:	Q7LXP0	Sequences: MVELSEPLENYLKEMYEIEEIKGSAKVSELISIFNISPGTISKALNKLEKLGLVERTNDRKIKLTEEGKRIAERLIKSHRLSERLLTDIVGVDWIRAHELAHRLEHIWPDDILERIDRLLGYPTTCPHGHPIGNRIKVSGKKLSEINIAGKYKVVMIVREEEWILREATRLGLKPGVVLEVIENNGTDIKIKIGEEIEEVSKVIGDQVLVIG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	212 (206)
Sequences:	1599 (1136)
Seq/√Len:	79.1

ECOLI - MNTR
BACSU - MNTR
HALSA - Q9HRU8 Q9HRV3 Q9HME7 Q9HR69
SULSO - Q7LXP0 Q97WF3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
146_I	152_Y	5.443	1.00
134_N	138_V	3.697	1.00
180_E	192_K	3.509	1.00
96_R	111_D	3.346	1.00
19_E	69_K	3.288	1.00
154_V	208_V	3.187	1.00
151_K	180_E	3.112	1.00
15_M	54_V	2.995	1.00
84_R	88_D	2.911	1.00
152_Y	210_V	2.759	1.00
117_D	122_Y	2.679	1.00
151_K	178_V	2.642	1.00
114_E	135_R	2.638	1.00
108_W	113_L	2.506	1.00
94_W	165_L	2.447	1.00
82_S	108_W	2.376	1.00
100_L	109_P	2.237	1.00
164_I	204_I	2.158	1.00
147_N	150_G	2.123	1.00
13_K	102_H	2.122	1.00
120_L	123_P	2.120	1.00
13_K	126_C	2.088	1.00
118_R	122_Y	2.078	1.00
152_Y	179_L	2.013	1.00
85_L	90_V	1.997	1.00
45_L	54_V	1.955	1.00
7_P	40_T	1.886	1.00
89_I	119_L	1.860	1.00
95_I	166_R	1.851	1.00
10_N	13_K	1.846	1.00
190_K	197_I	1.786	1.00
153_K	178_V	1.757	1.00
56_R	59_D	1.741	1.00
167_E	187_T	1.721	1.00
40_T	44_A	1.673	1.00
79_H	98_H	1.665	1.00
154_V	179_L	1.612	1.00
8_L	51_L	1.601	1.00
144_S	206_D	1.581	1.00
154_V	173_L	1.572	1.00
85_L	89_I	1.564	0.99
130_H	156_M	1.547	0.99
174_K	177_V	1.543	0.99
36_I	41_I	1.539	0.99
189_I	205_G	1.533	0.99
9_E	106_H	1.522	0.99
10_N	102_H	1.499	0.99
202_K	206_D	1.471	0.99
123_P	132_I	1.463	0.99
126_C	130_H	1.449	0.99
146_I	181_V	1.433	0.99
116_I	119_L	1.420	0.99
83_E	98_H	1.390	0.99
192_K	197_I	1.382	0.99
85_L	119_L	1.382	0.99
82_S	112_I	1.359	0.99
200_V	205_G	1.359	0.99
14_E	30_L	1.353	0.99
77_K	133_G	1.332	0.98
135_R	138_V	1.324	0.98
146_I	210_V	1.323	0.98
92_V	112_I	1.303	0.98
15_M	41_I	1.283	0.98
9_E	75_L	1.270	0.98
29_E	32_S	1.268	0.98
34_F	44_A	1.248	0.97
27_V	42_S	1.247	0.97
115_R	118_R	1.234	0.97
27_V	38_P	1.217	0.97
15_M	30_L	1.203	0.97
182_I	192_K	1.202	0.97
67_E	70_R	1.199	0.97
183_E	190_K	1.185	0.97
80_R	132_I	1.183	0.97
30_L	41_I	1.162	0.96
9_E	105_E	1.148	0.96
100_L	103_R	1.141	0.96
108_W	112_I	1.129	0.95
93_D	96_R	1.113	0.95
74_R	78_S	1.091	0.95
66_E	69_K	1.084	0.94
192_K	195_E	1.063	0.94
55_E	63_K	1.032	0.93
34_F	38_P	1.029	0.93
19_E	25_A	1.027	0.93
156_M	209_L	1.026	0.93
183_E	196_E	1.023	0.92
87_T	97_A	0.997	0.91
81_L	117_D	0.991	0.91
148_I	183_E	0.984	0.91
146_I	150_G	0.983	0.91
49_E	56_R	0.982	0.91
123_P	133_G	0.970	0.90
129_G	133_G	0.970	0.90
78_S	113_L	0.969	0.90
129_G	132_I	0.965	0.90
179_L	191_I	0.958	0.90
83_E	129_G	0.958	0.90
162_E	166_R	0.948	0.89
11_Y	40_T	0.941	0.89
80_R	83_E	0.940	0.89
191_I	200_V	0.938	0.89
27_V	41_I	0.937	0.89
37_S	43_K	0.934	0.89
100_L	108_W	0.919	0.88
168_A	173_L	0.918	0.88
85_L	116_I	0.913	0.87
86_L	97_A	0.913	0.87
80_R	133_G	0.913	0.87
69_K	73_E	0.910	0.87
140_G	155_V	0.903	0.87
11_Y	41_I	0.902	0.87
37_S	44_A	0.901	0.87
172_G	208_V	0.901	0.87
125_T	149_A	0.899	0.87
49_E	52_G	0.899	0.87
172_G	177_V	0.897	0.86
45_L	62_I	0.894	0.86
92_V	96_R	0.888	0.86
6_E	25_A	0.876	0.85
182_I	197_I	0.874	0.85
14_E	34_F	0.874	0.85
77_K	132_I	0.872	0.85
182_I	190_K	0.871	0.85
67_E	71_I	0.863	0.84
111_D	115_R	0.862	0.84
102_H	106_H	0.857	0.84
102_H	105_E	0.855	0.84
27_V	44_A	0.854	0.84
82_S	116_I	0.854	0.84
79_H	128_H	0.854	0.84
16_Y	44_A	0.853	0.84
41_I	45_L	0.849	0.83
16_Y	76_I	0.847	0.83
37_S	40_T	0.835	0.82
79_H	83_E	0.829	0.82
36_I	40_T	0.825	0.81
185_N	188_D	0.825	0.81
78_S	110_D	0.824	0.81
140_G	209_L	0.821	0.81
124_T	153_K	0.819	0.81
52_G	67_E	0.812	0.80
91_G	115_R	0.811	0.80
55_E	93_D	0.809	0.80
90_V	116_I	0.808	0.80
93_D	115_R	0.804	0.80
54_V	57_T	0.801	0.79
94_W	128_H	0.796	0.79
83_E	128_H	0.796	0.79
75_L	78_S	0.792	0.79
120_L	132_I	0.792	0.79
79_H	106_H	0.788	0.78
78_S	107_I	0.786	0.78
7_P	10_N	0.786	0.78
83_E	132_I	0.785	0.78
100_L	107_I	0.780	0.78
128_H	132_I	0.774	0.77
112_I	116_I	0.764	0.76
66_E	70_R	0.764	0.76
187_T	202_K	0.763	0.76
185_N	190_K	0.758	0.76
52_G	150_G	0.756	0.75
133_G	137_K	0.756	0.75
9_E	78_S	0.754	0.75
8_L	16_Y	0.752	0.75
169_T	174_K	0.748	0.75
18_I	107_I	0.748	0.75
90_V	119_L	0.747	0.75
27_V	45_L	0.743	0.74
18_I	44_A	0.742	0.74
31_I	95_I	0.736	0.73
28_S	38_P	0.729	0.73
17_E	75_L	0.728	0.73
80_R	123_P	0.727	0.73
10_N	107_I	0.727	0.73
141_K	145_E	0.726	0.72
98_H	128_H	0.721	0.72
25_A	30_L	0.717	0.72
8_L	44_A	0.717	0.72
178_V	195_E	0.716	0.71
190_K	199_E	0.711	0.71
152_Y	181_V	0.708	0.71
145_E	183_E	0.707	0.70
141_K	150_G	0.705	0.70
154_V	171_L	0.705	0.70
79_H	105_E	0.704	0.70
201_S	204_I	0.704	0.70
47_K	104_L	0.701	0.70
13_K	17_E	0.701	0.70
7_P	44_A	0.699	0.70
81_L	116_I	0.693	0.69
142_K	206_D	0.691	0.69
127_P	132_I	0.687	0.68
142_K	145_E	0.686	0.68
36_I	44_A	0.685	0.68
104_L	112_I	0.677	0.67
77_K	131_P	0.660	0.65
152_Y	191_I	0.660	0.65
83_E	133_G	0.657	0.65
193_I	196_E	0.657	0.65
58_N	63_K	0.657	0.65
95_I	169_T	0.655	0.65
97_A	128_H	0.653	0.64
14_E	33_I	0.653	0.64
76_I	140_G	0.649	0.64
27_V	56_R	0.648	0.64
195_E	200_V	0.647	0.64
7_P	39_G	0.646	0.64
86_L	101_A	0.645	0.63
57_T	63_K	0.644	0.63
117_D	134_N	0.640	0.63
54_V	59_D	0.634	0.62
141_K	147_N	0.632	0.62
126_C	133_G	0.630	0.62
27_V	61_K	0.628	0.61
56_R	62_I	0.626	0.61
6_E	91_G	0.623	0.61
153_K	210_V	0.617	0.60
83_E	123_P	0.616	0.60
181_V	198_E	0.615	0.60
113_L	117_D	0.614	0.60
86_L	98_H	0.614	0.60
198_E	204_I	0.611	0.59
18_I	25_A	0.609	0.59
127_P	133_G	0.607	0.59
48_L	53_L	0.606	0.59
5_S	36_I	0.605	0.59
92_V	100_L	0.604	0.58
98_H	132_I	0.604	0.58
44_A	47_K	0.601	0.58
80_R	127_P	0.599	0.58
46_N	56_R	0.599	0.58
39_G	44_A	0.599	0.58
10_N	105_E	0.597	0.58
66_E	93_D	0.596	0.57
102_H	128_H	0.593	0.57
78_S	100_L	0.591	0.57
9_E	85_L	0.585	0.56
27_V	36_I	0.583	0.56
43_K	46_N	0.581	0.55
145_E	151_K	0.580	0.55
146_I	149_A	0.579	0.55
15_M	64_L	0.578	0.55
38_P	44_A	0.577	0.55
37_S	42_S	0.576	0.55
61_K	90_V	0.574	0.55
13_K	105_E	0.574	0.55
71_I	114_E	0.573	0.54
5_S	8_L	0.571	0.54
82_S	85_L	0.568	0.54
114_E	118_R	0.566	0.54
76_I	80_R	0.565	0.53
96_R	123_P	0.562	0.53
39_G	113_L	0.562	0.53
12_L	24_S	0.561	0.53
8_L	28_S	0.557	0.52
10_N	100_L	0.557	0.52
78_S	108_W	0.557	0.52
43_K	112_I	0.553	0.52
75_L	100_L	0.552	0.52
128_H	165_L	0.551	0.52
177_V	194_G	0.551	0.52
67_E	154_V	0.550	0.52
30_L	45_L	0.550	0.52
9_E	44_A	0.549	0.51
124_T	196_E	0.547	0.51
114_E	122_Y	0.545	0.51
146_I	192_K	0.545	0.51
148_I	174_K	0.545	0.51
44_A	60_R	0.544	0.51
52_G	157_I	0.542	0.50
194_G	199_E	0.542	0.50
34_F	75_L	0.542	0.50
142_K	209_L	0.541	0.50
154_V	210_V	0.541	0.50
38_P	42_S	0.540	0.50
81_L	123_P	0.537	0.50
42_S	61_K	0.536	0.50
83_E	120_L	0.533	0.49
82_S	104_L	0.531	0.49
173_L	193_I	0.531	0.49
13_K	73_E	0.531	0.49
28_S	51_L	0.529	0.49
77_K	137_K	0.529	0.49
82_S	100_L	0.528	0.49
154_V	180_E	0.528	0.49
41_I	205_G	0.527	0.49
42_S	56_R	0.527	0.49
123_P	128_H	0.527	0.49
148_I	184_N	0.524	0.48
76_I	128_H	0.524	0.48
31_I	45_L	0.524	0.48
86_L	127_P	0.521	0.48
100_L	156_M	0.516	0.47
149_A	163_W	0.515	0.47
22_K	99_E	0.514	0.47
134_N	137_K	0.514	0.47
17_E	33_I	0.513	0.47
27_V	62_I	0.511	0.46
40_T	43_K	0.509	0.46
28_S	92_V	0.508	0.46
82_S	113_L	0.507	0.46
20_E	69_K	0.507	0.46
110_D	113_L	0.506	0.46
164_I	208_V	0.506	0.46
10_N	156_M	0.503	0.45
59_D	62_I	0.503	0.45
43_K	130_H	0.502	0.45
190_K	193_I	0.500	0.45

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1fx7A	4	1	100	0.349	Contact Map
2qq9A	2	0.9623	100	0.367	Contact Map
4o5vA	2	0.9811	100	0.374	Contact Map
3hrsA	2	0.9764	100	0.394	Contact Map
2x4hA	3	0.6179	99.9	0.67	Contact Map
1on2A	2	0.6368	99.8	0.694	Contact Map
2p8tA	1	0.783	99.7	0.733	Contact Map
2h09A	2	0.566	99.7	0.735	Contact Map
2k5fA	1	0.3349	99.1	0.805	Contact Map
2k5lA	1	0.3396	99.1	0.806	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.