Q7LXN3 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXN3 - Molybdopterin-guanine dinucleotide biosynthesis protein A (MobA)

UniProt:	Q7LXN3	Sequences: MSYNNSYDVIILAGGLSKRFGADKCCFEVNSKTMLDRLLEQFDNPIVVSRSPRRIKKGILVIEKGEYEGPVKGVREGLKYVRRDRVFITGCDFPFLIKNLVDYVCSKPYDIVIPFDHRPQPLLACYSTELLNKNIDKINGLVELIELSSSVYFIGTEELLKIDPFLYSLININSIIDLIYRPIRIKTKSNFILR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	194 (172)
Sequences:	3318 (2642)
Seq/√Len:	201.4

ECOLI - MOBA MOCA
BACSU - MOBA PUCB
HALSA - Q9HR78
SULSO - Q7LXN3 Q97W15

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
32_K	40_E	5.129	1.00
10_I	77_G	3.194	1.00
33_T	36_D	3.112	1.00
25_C	91_C	3.039	1.00
87_F	101_V	2.926	1.00
95_F	181_R	2.920	1.00
20_F	27_F	2.854	1.00
8_D	83_R	2.666	1.00
81_V	86_V	2.481	1.00
79_K	135_I	2.216	1.00
143_E	146_E	2.191	1.00
27_F	178_L	2.065	1.00
9_V	42_F	1.958	1.00
8_D	44_N	1.942	1.00
75_R	135_I	1.853	1.00
174_S	177_D	1.827	1.00
10_I	86_V	1.799	1.00
32_K	36_D	1.779	1.00
74_V	88_I	1.766	1.00
75_R	79_K	1.759	1.00
68_E	142_V	1.725	1.00
13_A	47_V	1.717	1.00
8_D	81_V	1.674	1.00
85_R	127_S	1.668	1.00
110_D	127_S	1.652	1.00
93_F	123_L	1.644	1.00
96_L	123_L	1.615	1.00
22_A	27_F	1.579	1.00
46_I	61_V	1.561	1.00
78_L	86_V	1.559	1.00
44_N	59_I	1.555	1.00
85_R	125_C	1.547	1.00
48_V	77_G	1.526	1.00
137_K	141_L	1.519	1.00
17_S	25_C	1.498	1.00
20_F	175_I	1.496	1.00
39_L	45_P	1.493	1.00
135_I	139_N	1.484	1.00
32_K	37_R	1.484	1.00
17_S	22_A	1.479	1.00
17_S	20_F	1.467	1.00
89_T	96_L	1.448	1.00
28_E	31_S	1.396	1.00
116_D	120_Q	1.396	1.00
34_M	38_L	1.381	1.00
100_L	168_S	1.376	1.00
72_K	76_E	1.374	1.00
39_L	58_G	1.316	1.00
144_L	147_L	1.315	1.00
90_G	93_F	1.312	1.00
49_S	60_L	1.302	1.00
87_F	125_C	1.299	1.00
36_D	40_E	1.293	1.00
179_I	182_P	1.274	1.00
110_D	155_G	1.273	1.00
10_I	48_V	1.264	1.00
111_I	148_S	1.243	1.00
141_L	146_E	1.220	1.00
119_P	158_E	1.214	1.00
178_L	182_P	1.214	1.00
74_V	144_L	1.212	1.00
90_G	123_L	1.209	1.00
97_I	168_S	1.200	1.00
137_K	147_L	1.188	1.00
11_I	35_L	1.172	1.00
134_N	147_L	1.162	1.00
145_I	149_S	1.147	1.00
110_D	129_E	1.132	1.00
64_K	79_K	1.130	1.00
81_V	128_T	1.113	1.00
48_V	61_V	1.107	1.00
172_I	181_R	1.104	1.00
170_I	181_R	1.104	1.00
9_V	38_L	1.096	1.00
90_G	126_Y	1.087	1.00
172_I	178_L	1.074	1.00
29_V	34_M	1.074	1.00
65_G	68_E	1.071	1.00
61_V	76_E	1.067	1.00
113_I	119_P	1.064	1.00
10_I	88_I	1.052	1.00
97_I	100_L	1.041	1.00
11_I	39_L	1.030	1.00
22_A	175_I	1.020	1.00
38_L	41_Q	1.002	1.00
111_I	154_I	0.998	1.00
34_M	172_I	0.994	1.00
42_F	87_F	0.990	1.00
38_L	89_T	0.983	1.00
28_E	33_T	0.982	1.00
79_K	131_L	0.978	1.00
176_I	179_I	0.977	1.00
105_C	125_C	0.974	1.00
155_G	159_L	0.973	1.00
77_G	86_V	0.973	1.00
16_L	67_Y	0.970	0.99
27_F	175_I	0.969	0.99
115_F	119_P	0.961	0.99
84_D	128_T	0.960	0.99
23_D	26_C	0.957	0.99
7_Y	105_C	0.957	0.99
136_D	140_G	0.955	0.99
37_R	41_Q	0.954	0.99
88_I	126_Y	0.951	0.99
8_D	46_I	0.940	0.99
95_F	170_I	0.931	0.99
111_I	114_P	0.916	0.99
133_K	147_L	0.913	0.99
111_I	156_T	0.903	0.99
140_G	150_S	0.900	0.99
133_K	150_S	0.895	0.99
7_Y	42_F	0.891	0.99
115_F	158_E	0.888	0.99
145_I	148_S	0.886	0.99
51_S	54_R	0.886	0.99
71_V	134_N	0.882	0.99
30_N	37_R	0.866	0.99
86_V	128_T	0.861	0.99
113_I	124_A	0.858	0.99
102_D	106_S	0.858	0.99
71_V	138_I	0.857	0.99
104_V	112_V	0.847	0.99
115_F	160_L	0.846	0.99
68_E	138_I	0.845	0.99
69_G	72_K	0.842	0.99
146_E	149_S	0.837	0.99
136_D	139_N	0.836	0.98
33_T	37_R	0.836	0.98
130_L	133_K	0.835	0.98
65_G	75_R	0.831	0.98
15_G	19_R	0.829	0.98
156_T	159_L	0.828	0.98
68_E	72_K	0.819	0.98
133_K	137_K	0.818	0.98
176_I	180_Y	0.808	0.98
46_I	80_Y	0.803	0.98
128_T	131_L	0.798	0.98
74_V	126_Y	0.794	0.98
50_R	69_G	0.794	0.98
84_D	127_S	0.794	0.98
25_C	35_L	0.783	0.98
133_K	136_D	0.782	0.98
93_F	122_L	0.780	0.98
99_N	103_Y	0.776	0.98
59_I	80_Y	0.776	0.98
156_T	161_K	0.776	0.98
170_I	180_Y	0.775	0.98
14_G	70_P	0.771	0.97
28_E	32_K	0.767	0.97
70_P	73_G	0.759	0.97
72_K	75_R	0.746	0.97
42_F	101_V	0.745	0.97
108_P	112_V	0.736	0.97
113_I	156_T	0.732	0.97
89_T	101_V	0.732	0.97
50_R	62_I	0.728	0.96
11_I	45_P	0.728	0.96
28_E	182_P	0.723	0.96
35_L	47_V	0.716	0.96
61_V	77_G	0.711	0.96
14_G	19_R	0.710	0.96
114_P	161_K	0.705	0.96
84_D	129_E	0.702	0.96
46_I	81_V	0.700	0.96
118_R	145_I	0.698	0.95
177_D	180_Y	0.694	0.95
63_E	173_N	0.691	0.95
17_S	23_D	0.688	0.95
30_N	182_P	0.688	0.95
63_E	73_G	0.686	0.95
43_D	83_R	0.684	0.95
163_D	168_S	0.680	0.95
29_V	37_R	0.680	0.95
137_K	146_E	0.680	0.95
64_K	75_R	0.674	0.95
113_I	148_S	0.673	0.94
133_K	154_I	0.671	0.94
41_Q	96_L	0.667	0.94
14_G	73_G	0.666	0.94
108_P	127_S	0.663	0.94
35_L	39_L	0.662	0.94
122_L	126_Y	0.659	0.94
144_L	148_S	0.653	0.94
107_K	112_V	0.652	0.94
41_Q	98_K	0.650	0.93
61_V	80_Y	0.645	0.93
51_S	55_I	0.643	0.93
78_L	81_V	0.641	0.93
156_T	160_L	0.636	0.93
20_F	172_I	0.633	0.92
44_N	83_R	0.631	0.92
131_L	135_I	0.630	0.92
121_P	145_I	0.629	0.92
124_A	148_S	0.627	0.92
132_N	135_I	0.623	0.92
7_Y	101_V	0.621	0.92
53_R	62_I	0.619	0.92
157_E	160_L	0.615	0.91
155_G	158_E	0.614	0.91
23_D	51_S	0.613	0.91
175_I	179_I	0.611	0.91
71_V	147_L	0.610	0.91
38_L	96_L	0.609	0.91
95_F	167_Y	0.602	0.91
20_F	23_D	0.598	0.90
112_V	125_C	0.598	0.90
98_K	102_D	0.598	0.90
38_L	178_L	0.596	0.90
163_D	166_L	0.595	0.90
104_V	125_C	0.593	0.90
65_G	72_K	0.590	0.90
23_D	52_P	0.589	0.90
43_D	46_I	0.588	0.89
77_G	81_V	0.587	0.89
132_N	136_D	0.586	0.89
48_V	76_E	0.585	0.89
24_K	92_D	0.584	0.89
154_I	162_I	0.582	0.89
103_Y	107_K	0.581	0.89
99_N	102_D	0.578	0.89
49_S	53_R	0.578	0.89
34_M	91_C	0.577	0.89
100_L	104_V	0.575	0.88
93_F	120_Q	0.572	0.88
100_L	114_P	0.570	0.88
107_K	157_E	0.569	0.88
17_S	178_L	0.568	0.88
143_E	147_L	0.566	0.88
102_D	105_C	0.564	0.87
73_G	76_E	0.563	0.87
10_I	81_V	0.556	0.87
9_V	89_T	0.550	0.86
157_E	180_Y	0.548	0.86
7_Y	125_C	0.547	0.86
17_S	21_G	0.546	0.86
14_G	63_E	0.545	0.86
73_G	77_G	0.543	0.85
158_E	162_I	0.543	0.85
113_I	121_P	0.543	0.85
8_D	86_V	0.535	0.85
75_R	138_I	0.535	0.85
146_E	150_S	0.534	0.84
134_N	137_K	0.531	0.84
12_L	19_R	0.529	0.84
17_S	175_I	0.529	0.84
12_L	15_G	0.529	0.84
10_I	46_I	0.527	0.84
109_Y	114_P	0.523	0.83
121_P	126_Y	0.518	0.83
154_I	161_K	0.517	0.83
26_C	35_L	0.514	0.82
69_G	142_V	0.514	0.82
29_V	181_R	0.513	0.82
154_I	157_E	0.507	0.81
89_T	123_L	0.506	0.81
136_D	150_S	0.505	0.81
103_Y	162_I	0.504	0.81
141_L	147_L	0.500	0.80

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1e5kA	1	0.9021	100	0.388	Contact Map
2e8bA	1	0.8711	100	0.4	Contact Map
3ngwA	2	0.9124	100	0.413	Contact Map
2weeA	1	0.9072	100	0.448	Contact Map
2wawA	1	0.9278	100	0.455	Contact Map
3d5nA	2	0.8608	100	0.464	Contact Map
2px7A	2	0.8608	99.9	0.543	Contact Map
3rsbA	1	0.799	99.9	0.548	Contact Map
1vpaA	2	0.9175	99.9	0.568	Contact Map
2xmeA	3	0.8505	99.9	0.574	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.