Q7LXL8 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXL8 - Uncharacterized protein

UniProt:	Q7LXL8	Sequences: MKKFLKMFFPHDGIYEVLVGTSGIKPIIKPLGIIVEANELRSKIYKSTLTYSNLEKNNKCSIHVTLDTTFFILSMLDKLTFSIDSDYNVPVLKNLNVIYAECMKTSSTDPSIFTINPLDLEINSNLTRAYNRGDYISVDFLVNYTRLDIYKGEDLEKLVRILEYEWSVIKRTSQYTSSLLEEILNKMRSKGFKLD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	195 (172)
Sequences:	279 (224)
Seq/√Len:	17.1

SULSO - Q7LXL8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_V	33_I	3.815	1.00
20_G	28_I	3.498	1.00
173_S	176_T	3.215	0.99
106_S	112_I	3.181	0.99
101_E	116_N	3.054	0.99
33_I	63_H	2.954	0.98
33_I	62_I	2.566	0.96
100_A	145_T	2.546	0.96
73_L	182_E	2.536	0.96
61_S	99_Y	2.491	0.96
55_E	113_F	2.388	0.94
34_I	62_I	2.211	0.92
102_C	115_I	2.151	0.90
166_W	170_K	2.110	0.90
62_I	145_T	2.005	0.87
143_N	161_I	1.991	0.87
130_Y	134_D	1.990	0.87
72_I	183_I	1.986	0.86
23_G	138_V	1.829	0.81
176_T	179_L	1.815	0.81
173_S	179_L	1.813	0.81
102_C	113_F	1.793	0.80
31_L	44_I	1.784	0.80
64_V	98_I	1.763	0.79
21_T	53_N	1.643	0.74
62_I	144_Y	1.598	0.72
60_C	100_A	1.597	0.72
73_L	81_F	1.570	0.70
98_I	117_P	1.485	0.66
35_V	40_L	1.458	0.64
27_I	97_V	1.439	0.63
63_H	145_T	1.408	0.62
47_S	51_Y	1.371	0.59
65_T	135_Y	1.370	0.59
144_Y	187_M	1.361	0.59
18_L	76_L	1.335	0.57
31_L	63_H	1.325	0.57
75_M	140_F	1.320	0.56
122_I	178_S	1.295	0.55
131_N	173_S	1.294	0.55
18_L	156_E	1.289	0.55
84_D	91_V	1.284	0.54
137_S	179_L	1.275	0.54
71_F	96_N	1.272	0.54
159_V	163_E	1.263	0.53
177_S	181_E	1.260	0.53
121_E	156_E	1.259	0.53
147_L	164_Y	1.241	0.52
68_T	134_D	1.234	0.51
30_P	48_T	1.234	0.51
25_K	56_K	1.233	0.51
169_I	180_L	1.228	0.51
25_K	84_D	1.226	0.51
38_N	178_S	1.216	0.50
50_T	53_N	1.210	0.50
24_I	49_L	1.206	0.50
75_M	144_Y	1.204	0.50
51_Y	55_E	1.187	0.48
159_V	184_L	1.185	0.48
131_N	168_V	1.172	0.48
73_L	76_L	1.152	0.46
22_S	57_N	1.147	0.46
90_P	136_I	1.139	0.46
37_A	101_E	1.138	0.46
58_N	138_V	1.132	0.45
177_S	185_N	1.130	0.45
54_L	113_F	1.110	0.44
19_V	26_P	1.100	0.43
131_N	171_R	1.095	0.43
26_P	31_L	1.094	0.43
114_T	184_L	1.073	0.42
18_L	133_G	1.060	0.41
54_L	115_I	1.059	0.41
33_I	64_V	1.051	0.40
105_T	138_V	1.042	0.40
161_I	164_Y	1.039	0.40
64_V	96_N	1.036	0.40
76_L	81_F	1.036	0.40
14_I	172_T	1.016	0.38
140_F	169_I	1.014	0.38
125_N	173_S	1.009	0.38
60_C	115_I	1.006	0.38
38_N	174_Q	1.003	0.38
131_N	176_T	0.998	0.37
72_I	184_L	0.996	0.37
141_L	150_Y	0.996	0.37
162_L	166_W	0.992	0.37
67_D	137_S	0.986	0.37
16_E	21_T	0.982	0.37
18_L	30_P	0.978	0.36
72_I	131_N	0.975	0.36
15_Y	98_I	0.973	0.36
140_F	162_L	0.968	0.36
80_T	142_V	0.965	0.36
15_Y	140_F	0.960	0.35
109_D	112_I	0.958	0.35
72_I	141_L	0.956	0.35
45_Y	82_S	0.951	0.35
73_L	82_S	0.951	0.35
99_Y	119_D	0.950	0.35
31_L	40_L	0.944	0.34
104_K	122_I	0.943	0.34
155_L	160_R	0.941	0.34
109_D	175_Y	0.933	0.34
43_K	112_I	0.930	0.34
135_Y	160_R	0.927	0.34
61_S	86_D	0.926	0.33
129_A	133_G	0.925	0.33
155_L	159_V	0.923	0.33
65_T	138_V	0.920	0.33
89_V	99_Y	0.917	0.33
58_N	102_C	0.917	0.33
17_V	56_K	0.909	0.33
159_V	183_I	0.908	0.33
54_L	170_K	0.906	0.32
37_A	93_K	0.904	0.32
18_L	122_I	0.903	0.32
97_V	147_L	0.902	0.32
141_L	161_I	0.895	0.32
53_N	146_R	0.895	0.32
15_Y	102_C	0.893	0.32
72_I	176_T	0.888	0.31
33_I	42_S	0.885	0.31
24_I	177_S	0.885	0.31
77_D	151_K	0.879	0.31
16_E	32_G	0.870	0.31
18_L	63_H	0.869	0.31
32_G	132_R	0.865	0.30
39_E	65_T	0.861	0.30
26_P	90_P	0.857	0.30
75_M	141_L	0.855	0.30
33_I	145_T	0.852	0.30
88_N	174_Q	0.847	0.29
54_L	57_N	0.846	0.29
108_T	160_R	0.845	0.29
66_L	95_L	0.842	0.29
139_D	168_V	0.842	0.29
20_G	94_N	0.841	0.29
135_Y	142_V	0.838	0.29
62_I	100_A	0.817	0.28
126_L	167_S	0.817	0.28
41_R	133_G	0.811	0.28
24_I	98_I	0.808	0.27
118_L	123_N	0.799	0.27
23_G	90_P	0.798	0.27
143_N	165_E	0.797	0.27
72_I	143_N	0.792	0.27
54_L	102_C	0.785	0.26
133_G	139_D	0.781	0.26
141_L	183_I	0.781	0.26
136_I	168_V	0.780	0.26
47_S	180_L	0.779	0.26
129_A	172_T	0.778	0.26
31_L	74_S	0.775	0.26
76_L	138_V	0.769	0.26
15_Y	64_V	0.766	0.26
165_E	173_S	0.765	0.25
15_Y	40_L	0.763	0.25
39_E	114_T	0.762	0.25
104_K	114_T	0.760	0.25
54_L	142_V	0.760	0.25
19_V	177_S	0.753	0.25
145_T	170_K	0.748	0.25
160_R	163_E	0.746	0.25
77_D	131_N	0.745	0.25
24_I	148_D	0.741	0.24
64_V	71_F	0.739	0.24
44_I	129_A	0.738	0.24
26_P	119_D	0.737	0.24
62_I	65_T	0.736	0.24
34_I	102_C	0.728	0.24
42_S	49_L	0.728	0.24
31_L	51_Y	0.727	0.24
58_N	177_S	0.724	0.24
123_N	126_L	0.720	0.23
157_K	186_K	0.712	0.23
130_Y	138_V	0.708	0.23
44_I	142_V	0.705	0.23
136_I	176_T	0.702	0.23
157_K	164_Y	0.701	0.23
110_P	133_G	0.698	0.23
59_K	99_Y	0.692	0.22
75_M	186_K	0.692	0.22
77_D	139_D	0.689	0.22
68_T	143_N	0.689	0.22
184_L	188_R	0.685	0.22
36_E	90_P	0.678	0.22
181_E	185_N	0.677	0.22
79_L	87_Y	0.670	0.21
34_I	145_T	0.669	0.21
21_T	177_S	0.668	0.21
167_S	171_R	0.667	0.21
16_E	30_P	0.662	0.21
59_K	94_N	0.661	0.21
51_Y	56_K	0.661	0.21
43_K	142_V	0.660	0.21
125_N	181_E	0.659	0.21
18_L	65_T	0.653	0.21
31_L	142_V	0.651	0.21
17_V	62_I	0.640	0.20
19_V	22_S	0.638	0.20
40_L	138_V	0.637	0.20
143_N	158_L	0.632	0.20
33_I	184_L	0.629	0.20
76_L	183_I	0.625	0.20
21_T	102_C	0.622	0.20
48_T	162_L	0.621	0.19
38_N	173_S	0.615	0.19
163_E	175_Y	0.615	0.19
174_Q	186_K	0.610	0.19
97_V	137_S	0.606	0.19
62_I	84_D	0.606	0.19
72_I	179_L	0.605	0.19
89_V	118_L	0.604	0.19
91_V	133_G	0.603	0.19
136_I	169_I	0.602	0.19
80_T	185_N	0.601	0.19
72_I	147_L	0.594	0.18
85_S	90_P	0.590	0.18
76_L	182_E	0.587	0.18
37_A	70_F	0.585	0.18
43_K	186_K	0.583	0.18
45_Y	112_I	0.581	0.18
109_D	174_Q	0.572	0.18
48_T	171_R	0.567	0.18
22_S	88_N	0.566	0.18
162_L	188_R	0.564	0.17
97_V	179_L	0.563	0.17
34_I	100_A	0.561	0.17
16_E	132_R	0.544	0.17
38_N	71_F	0.544	0.17
21_T	25_K	0.542	0.17
87_Y	101_E	0.539	0.17
60_C	165_E	0.537	0.17
128_R	184_L	0.536	0.16
132_R	146_R	0.534	0.16
148_D	159_V	0.532	0.16
20_G	50_T	0.531	0.16
143_N	176_T	0.529	0.16
100_A	147_L	0.529	0.16
107_S	178_S	0.529	0.16
84_D	93_K	0.528	0.16
118_L	163_E	0.527	0.16
83_I	111_S	0.519	0.16
17_V	135_Y	0.517	0.16
124_S	173_S	0.516	0.16
31_L	43_K	0.515	0.16
76_L	162_L	0.514	0.16
65_T	71_F	0.513	0.16
62_I	169_I	0.512	0.16
88_N	119_D	0.511	0.16
66_L	150_Y	0.511	0.16
70_F	142_V	0.510	0.16
127_T	167_S	0.508	0.16
144_Y	172_T	0.508	0.16
175_Y	178_S	0.503	0.15
94_N	109_D	0.500	0.15
29_K	45_Y	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2nr4A	2	0.9282	100	0.503	Contact Map
2imlA	2	0.959	100	0.503	Contact Map
2ptfA	2	0.9436	100	0.524	Contact Map
3b5mA	2	0.9026	100	0.544	Contact Map
4f07A	6	0.6923	98.4	0.843	Contact Map
3fgeA	2	0.8154	98.2	0.852	Contact Map
2d5mA	2	0.8205	98.2	0.852	Contact Map
4l82A	2	0.6872	98.2	0.853	Contact Map
3bnkA	2	0.8205	98.1	0.854	Contact Map
3e4vA	2	0.7846	98.1	0.855	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.