Q7LXL1 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXL1 - Uncharacterized protein

UniProt:	Q7LXL1	Sequences: MKINQAIISVFIHETEDYNKIVNTIESFFSPLISNSKKNVTTAQGHYGNKIIILEYRFDRKSGEQFFKIILEKIETSELMLILTTIDSHIDGSKLYLRFDKQYLIAEHRLVLKEGDDVIKCIISFNTSLENIKEEIKKLVNSRIMHSKL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	149 (130)
Sequences:	171 (139)
Seq/√Len:	12.2

HALSA - Q9HQ79
SULSO - Q7LXL1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_H	49_N	3.960	0.99
91_D	94_K	3.334	0.98
21_I	104_L	3.304	0.98
39_N	44_Q	2.959	0.95
74_I	99_F	2.757	0.93
15_T	102_Q	2.509	0.89
100_D	103_Y	2.356	0.86
6_A	70_I	2.231	0.83
57_R	99_F	2.177	0.81
29_F	97_L	2.119	0.79
85_T	89_H	1.977	0.74
82_I	95_L	1.964	0.74
100_D	113_K	1.958	0.74
63_G	91_D	1.932	0.73
25_I	38_K	1.899	0.71
13_H	130_E	1.794	0.67
5_Q	8_I	1.744	0.64
66_F	70_I	1.737	0.64
19_N	82_I	1.664	0.61
9_S	126_N	1.656	0.60
91_D	95_L	1.610	0.58
124_S	129_L	1.539	0.54
49_N	102_Q	1.488	0.52
24_T	106_A	1.487	0.52
4_N	127_T	1.474	0.51
83_L	119_I	1.456	0.50
87_D	109_R	1.447	0.50
63_G	115_G	1.443	0.50
66_F	119_I	1.433	0.49
75_E	109_R	1.423	0.49
25_I	29_F	1.413	0.48
38_K	56_Y	1.403	0.48
41_T	56_Y	1.401	0.47
6_A	30_S	1.384	0.47
82_I	97_L	1.381	0.46
103_Y	109_R	1.374	0.46
94_K	122_I	1.298	0.42
21_I	106_A	1.292	0.42
29_F	55_E	1.289	0.42
17_D	65_Q	1.286	0.42
92_G	95_L	1.232	0.39
56_Y	136_I	1.229	0.39
124_S	135_E	1.218	0.38
21_I	24_T	1.173	0.36
95_L	112_L	1.148	0.35
9_S	104_L	1.147	0.35
94_K	124_S	1.146	0.35
39_N	85_T	1.140	0.35
6_A	84_T	1.135	0.35
60_R	75_E	1.095	0.33
63_G	75_E	1.085	0.32
129_L	135_E	1.076	0.32
44_Q	91_D	1.076	0.32
98_R	136_I	1.076	0.32
16_E	101_K	1.072	0.32
18_Y	100_D	1.068	0.32
36_S	114_E	1.067	0.31
128_S	135_E	1.064	0.31
27_S	119_I	1.061	0.31
24_T	121_C	1.051	0.31
38_K	88_S	1.050	0.31
74_I	108_H	1.047	0.31
118_V	128_S	1.041	0.30
28_F	67_F	1.031	0.30
9_S	25_I	1.015	0.29
84_T	100_D	1.007	0.29
75_E	115_G	0.998	0.29
11_F	52_I	0.997	0.29
51_I	63_G	0.997	0.29
8_I	121_C	0.983	0.28
8_I	38_K	0.982	0.28
4_N	124_S	0.981	0.28
7_I	122_I	0.966	0.27
131_N	138_K	0.966	0.27
132_I	136_I	0.947	0.26
43_A	127_T	0.944	0.26
48_G	75_E	0.943	0.26
47_Y	88_S	0.933	0.26
30_S	104_L	0.929	0.26
12_I	54_L	0.921	0.25
104_L	129_L	0.916	0.25
81_L	85_T	0.916	0.25
29_F	49_N	0.910	0.25
4_N	126_N	0.901	0.25
98_R	112_L	0.896	0.25
125_F	135_E	0.891	0.24
45_G	117_D	0.889	0.24
17_D	92_G	0.889	0.24
87_D	115_G	0.888	0.24
37_K	109_R	0.883	0.24
4_N	95_L	0.879	0.24
15_T	49_N	0.872	0.24
19_N	26_E	0.864	0.23
65_Q	68_K	0.863	0.23
25_I	67_F	0.859	0.23
60_R	128_S	0.857	0.23
114_E	120_K	0.855	0.23
7_I	57_R	0.848	0.23
18_Y	40_V	0.840	0.22
87_D	95_L	0.836	0.22
20_K	50_K	0.835	0.22
107_E	133_K	0.833	0.22
90_I	136_I	0.830	0.22
82_I	98_R	0.817	0.22
108_H	118_V	0.808	0.21
38_K	74_I	0.806	0.21
72_E	112_L	0.800	0.21
43_A	47_Y	0.798	0.21
77_S	98_R	0.797	0.21
43_A	65_Q	0.795	0.21
5_Q	57_R	0.790	0.21
54_L	135_E	0.790	0.21
78_E	81_L	0.784	0.21
77_S	112_L	0.774	0.20
79_L	94_K	0.771	0.20
18_Y	47_Y	0.770	0.20
17_D	57_R	0.755	0.20
127_T	130_E	0.753	0.20
54_L	112_L	0.733	0.19
46_H	139_L	0.729	0.19
96_Y	99_F	0.719	0.19
90_I	96_Y	0.714	0.18
82_I	138_K	0.712	0.18
92_G	124_S	0.710	0.18
10_V	131_N	0.709	0.18
53_I	61_K	0.707	0.18
40_V	119_I	0.702	0.18
78_E	119_I	0.701	0.18
134_E	137_K	0.699	0.18
48_G	118_V	0.681	0.17
48_G	51_I	0.679	0.17
60_R	126_N	0.671	0.17
59_D	63_G	0.669	0.17
86_I	108_H	0.668	0.17
119_I	131_N	0.665	0.17
70_I	82_I	0.661	0.17
24_T	96_Y	0.660	0.17
9_S	125_F	0.657	0.17
38_K	89_H	0.651	0.17
19_N	76_T	0.648	0.16
37_K	75_E	0.645	0.16
42_T	72_E	0.644	0.16
36_S	72_E	0.641	0.16
10_V	40_V	0.634	0.16
79_L	91_D	0.630	0.16
9_S	106_A	0.630	0.16
14_E	82_I	0.628	0.16
72_E	82_I	0.623	0.16
11_F	127_T	0.622	0.16
26_E	30_S	0.621	0.16
99_F	110_L	0.620	0.16
8_I	90_I	0.614	0.16
132_I	137_K	0.611	0.15
9_S	55_E	0.608	0.15
30_S	111_V	0.608	0.15
28_F	79_L	0.607	0.15
9_S	53_I	0.602	0.15
66_F	97_L	0.600	0.15
53_I	86_I	0.597	0.15
46_H	49_N	0.596	0.15
14_E	43_A	0.596	0.15
45_G	101_K	0.591	0.15
16_E	45_G	0.591	0.15
15_T	46_H	0.591	0.15
58_F	79_L	0.590	0.15
5_Q	120_K	0.589	0.15
88_S	114_E	0.587	0.15
38_K	78_E	0.575	0.15
21_I	135_E	0.575	0.15
11_F	123_I	0.573	0.14
43_A	46_H	0.567	0.14
21_I	30_S	0.567	0.14
15_T	101_K	0.567	0.14
125_F	129_L	0.558	0.14
86_I	90_I	0.556	0.14
50_K	68_K	0.556	0.14
15_T	100_D	0.553	0.14
51_I	75_E	0.553	0.14
9_S	135_E	0.550	0.14
13_H	68_K	0.548	0.14
27_S	131_N	0.547	0.14
104_L	133_K	0.545	0.14
37_K	62_S	0.544	0.14
66_F	73_K	0.533	0.13
8_I	69_I	0.521	0.13
17_D	58_F	0.521	0.13
84_T	95_L	0.514	0.13
27_S	104_L	0.514	0.13
24_T	76_T	0.513	0.13
93_S	106_A	0.512	0.13
20_K	112_L	0.510	0.13
48_G	89_H	0.510	0.13
21_I	93_S	0.509	0.13
46_H	102_Q	0.500	0.13
110_L	119_I	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2nrqA	1	0.9128	100	0.274	Contact Map
2wnyA	1	0.8993	100	0.345	Contact Map
2ogkA	4	0.9262	100	0.348	Contact Map
2nwuA	2	0.8322	99.9	0.536	Contact Map
2pzzA	2	0.8658	99.9	0.539	Contact Map
3d7aA	2	0.8725	99.9	0.546	Contact Map
3c9gA	2	0.8456	99.9	0.554	Contact Map
4clfA	3	0.8658	19.3	0.944	Contact Map
2pt7G	2	0.5638	18.2	0.945	Contact Map
3cskA	1	0.8523	17.5	0.945	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.