Q7LXK5 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXK5 - Uncharacterized protein

UniProt:	Q7LXK5	Sequences: MQRKRIVRERVVYVLDYMREGNPLDKHKFHRDKPLIQAVGEDYFLLLELTPLSYNLDFLPEDKIELDSNSSVKVDAHISYEDLTSVSRDNLPKILYKIVFEKEKVFVEIFNKAEPLTLRLHALELLPNIGKKTLRIILEERKKKPFESFKDIESRIGVKDVASILVERIIKEMQGGEKYYLFVYPLIPDENKRLEQQFIYVGYIEKLK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	208 (176)
Sequences:	183 (131)
Seq/√Len:	9.9

HALSA - Q9HQH0
SULSO - Q7LXK5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
144_K	147_E	7.283	1.00
107_V	152_I	4.510	0.99
39_V	183_V	3.886	0.98
41_E	63_K	3.789	0.98
38_A	49_L	3.538	0.97
12_V	116_L	2.744	0.89
95_L	99_V	2.720	0.88
108_E	112_K	2.549	0.84
102_K	105_V	2.488	0.83
150_K	154_S	2.420	0.81
18_M	21_G	2.379	0.80
144_K	148_S	2.361	0.79
115_P	138_L	2.192	0.74
138_L	167_E	2.004	0.67
35_L	139_E	1.859	0.61
65_E	71_S	1.835	0.60
11_V	41_E	1.832	0.59
148_S	152_I	1.822	0.59
36_I	51_P	1.772	0.57
104_K	108_E	1.650	0.51
17_Y	99_V	1.631	0.50
21_G	34_P	1.625	0.50
100_F	165_L	1.620	0.50
103_E	107_V	1.579	0.48
90_N	93_K	1.568	0.48
92_P	110_F	1.565	0.47
117_T	157_G	1.561	0.47
23_P	30_H	1.480	0.44
45_L	74_V	1.476	0.43
115_P	157_G	1.463	0.43
31_R	176_G	1.457	0.43
113_A	156_I	1.456	0.43
20_E	45_L	1.435	0.42
51_P	110_F	1.433	0.41
120_L	179_Y	1.432	0.41
99_V	152_I	1.431	0.41
74_V	165_L	1.389	0.40
138_L	150_K	1.370	0.39
34_P	84_T	1.359	0.38
37_Q	84_T	1.351	0.38
99_V	166_V	1.342	0.38
110_F	124_E	1.327	0.37
74_V	171_K	1.318	0.37
117_T	140_E	1.302	0.36
116_L	179_Y	1.288	0.35
13_Y	41_E	1.272	0.35
8_R	68_S	1.262	0.34
64_I	137_I	1.258	0.34
145_P	149_F	1.253	0.34
31_R	175_G	1.251	0.34
118_L	134_L	1.233	0.33
113_A	163_S	1.228	0.33
157_G	177_E	1.218	0.32
21_G	127_P	1.209	0.32
67_D	71_S	1.209	0.32
51_P	58_F	1.196	0.32
50_T	157_G	1.194	0.31
118_L	135_R	1.187	0.31
9_E	40_G	1.182	0.31
95_L	118_L	1.169	0.30
66_L	71_S	1.167	0.30
166_V	170_I	1.167	0.30
127_P	178_K	1.165	0.30
65_E	77_H	1.158	0.30
60_P	140_E	1.137	0.29
39_V	95_L	1.126	0.29
79_S	91_L	1.126	0.29
37_Q	78_I	1.110	0.28
60_P	86_V	1.106	0.28
64_I	165_L	1.100	0.28
162_A	173_M	1.085	0.27
125_L	148_S	1.076	0.27
124_E	132_K	1.067	0.27
153_E	160_D	1.061	0.26
49_L	74_V	1.060	0.26
92_P	143_K	1.038	0.26
10_R	28_K	1.037	0.26
120_L	156_I	1.034	0.26
138_L	166_V	1.029	0.25
15_L	138_L	1.027	0.25
140_E	143_K	1.026	0.25
21_G	178_K	1.026	0.25
149_F	166_V	1.020	0.25
106_F	115_P	1.009	0.25
52_L	65_E	0.998	0.24
104_K	112_K	0.998	0.24
52_L	64_I	0.997	0.24
25_D	30_H	0.989	0.24
110_F	132_K	0.987	0.24
63_K	181_L	0.986	0.24
160_D	173_M	0.981	0.24
59_L	62_D	0.981	0.24
115_P	148_S	0.980	0.24
67_D	72_V	0.972	0.23
13_Y	174_Q	0.965	0.23
71_S	74_V	0.961	0.23
106_F	181_L	0.961	0.23
60_P	120_L	0.956	0.23
17_Y	127_P	0.952	0.23
14_V	26_K	0.951	0.23
21_G	35_L	0.944	0.23
89_D	97_K	0.921	0.22
69_N	72_V	0.918	0.22
47_L	67_D	0.908	0.21
70_S	73_K	0.901	0.21
48_E	134_L	0.901	0.21
116_L	163_S	0.898	0.21
124_E	133_T	0.898	0.21
35_L	126_L	0.894	0.21
47_L	77_H	0.892	0.21
35_L	137_I	0.891	0.21
52_L	71_S	0.891	0.21
81_E	115_P	0.889	0.21
7_V	119_R	0.882	0.21
58_F	175_G	0.876	0.20
18_M	34_P	0.871	0.20
80_Y	88_R	0.871	0.20
17_Y	178_K	0.871	0.20
82_D	104_K	0.870	0.20
96_Y	180_Y	0.866	0.20
105_V	158_V	0.863	0.20
41_E	153_E	0.855	0.20
120_L	170_I	0.849	0.20
63_K	137_I	0.847	0.20
80_Y	83_L	0.844	0.20
14_V	181_L	0.842	0.19
118_L	142_K	0.840	0.19
113_A	161_V	0.839	0.19
58_F	137_I	0.838	0.19
17_Y	171_K	0.835	0.19
14_V	144_K	0.832	0.19
98_I	102_K	0.827	0.19
153_E	159_K	0.825	0.19
33_K	47_L	0.825	0.19
49_L	152_I	0.824	0.19
96_Y	163_S	0.824	0.19
8_R	74_V	0.813	0.19
116_L	169_I	0.801	0.18
64_I	85_S	0.799	0.18
151_D	154_S	0.793	0.18
118_L	177_E	0.786	0.18
107_V	148_S	0.782	0.18
129_I	133_T	0.773	0.18
36_I	122_A	0.772	0.18
64_I	164_I	0.766	0.17
34_P	109_I	0.764	0.17
120_L	178_K	0.764	0.17
37_Q	88_R	0.763	0.17
74_V	77_H	0.761	0.17
60_P	94_I	0.761	0.17
14_V	58_F	0.756	0.17
13_Y	68_S	0.754	0.17
138_L	174_Q	0.753	0.17
158_V	177_E	0.752	0.17
35_L	87_S	0.752	0.17
38_A	112_K	0.751	0.17
10_R	57_D	0.742	0.17
28_K	90_N	0.737	0.17
12_V	38_A	0.732	0.16
24_L	55_N	0.727	0.16
37_Q	45_L	0.724	0.16
135_R	165_L	0.718	0.16
73_K	152_I	0.716	0.16
109_I	178_K	0.716	0.16
19_R	116_L	0.715	0.16
85_S	169_I	0.712	0.16
65_E	72_V	0.710	0.16
28_K	171_K	0.708	0.16
20_E	47_L	0.704	0.16
112_K	119_R	0.699	0.16
12_V	90_N	0.696	0.16
35_L	142_K	0.695	0.16
11_V	67_D	0.694	0.16
69_N	79_S	0.694	0.16
134_L	163_S	0.692	0.16
63_K	95_L	0.687	0.15
112_K	152_I	0.682	0.15
62_D	122_A	0.681	0.15
104_K	139_E	0.675	0.15
14_V	36_I	0.674	0.15
9_E	66_L	0.673	0.15
27_H	171_K	0.672	0.15
47_L	112_K	0.669	0.15
40_G	173_M	0.669	0.15
16_D	48_E	0.667	0.15
150_K	173_M	0.666	0.15
97_K	101_E	0.664	0.15
123_L	169_I	0.661	0.15
148_S	156_I	0.657	0.15
95_L	183_V	0.648	0.14
44_F	148_S	0.641	0.14
63_K	115_P	0.640	0.14
63_K	101_E	0.639	0.14
7_V	66_L	0.636	0.14
74_V	143_K	0.632	0.14
11_V	47_L	0.630	0.14
25_D	127_P	0.626	0.14
10_R	32_D	0.623	0.14
104_K	149_F	0.621	0.14
99_V	175_G	0.620	0.14
52_L	66_L	0.619	0.14
44_F	132_K	0.611	0.14
14_V	64_I	0.610	0.14
21_G	126_L	0.608	0.14
152_I	181_L	0.605	0.14
41_E	101_E	0.600	0.13
68_S	134_L	0.599	0.13
77_H	98_I	0.598	0.13
13_Y	26_K	0.598	0.13
13_Y	63_K	0.598	0.13
47_L	144_K	0.597	0.13
37_Q	129_I	0.595	0.13
36_I	97_K	0.594	0.13
107_V	125_L	0.593	0.13
32_D	135_R	0.589	0.13
30_H	164_I	0.588	0.13
90_N	134_L	0.586	0.13
45_L	78_I	0.586	0.13
126_L	149_F	0.582	0.13
9_E	73_K	0.581	0.13
61_E	138_L	0.578	0.13
19_R	96_Y	0.577	0.13
133_T	157_G	0.573	0.13
128_N	171_K	0.567	0.13
173_M	176_G	0.566	0.13
19_R	181_L	0.566	0.13
40_G	73_K	0.564	0.13
42_D	88_R	0.563	0.13
62_D	175_G	0.561	0.13
110_F	161_V	0.559	0.13
110_F	118_L	0.554	0.12
43_Y	124_E	0.554	0.12
22_N	59_L	0.552	0.12
160_D	175_G	0.551	0.12
82_D	170_I	0.546	0.12
30_H	51_P	0.545	0.12
152_I	156_I	0.544	0.12
115_P	171_K	0.543	0.12
10_R	67_D	0.542	0.12
60_P	93_K	0.542	0.12
45_L	65_E	0.542	0.12
117_T	131_K	0.541	0.12
28_K	107_V	0.540	0.12
150_K	153_E	0.538	0.12
160_D	166_V	0.537	0.12
127_P	132_K	0.536	0.12
36_I	98_I	0.535	0.12
165_L	171_K	0.534	0.12
11_V	74_V	0.534	0.12
17_Y	42_D	0.532	0.12
173_M	183_V	0.528	0.12
74_V	89_D	0.528	0.12
10_R	42_D	0.527	0.12
82_D	157_G	0.525	0.12
18_M	126_L	0.518	0.12
132_K	179_Y	0.516	0.12
14_V	25_D	0.516	0.12
31_R	47_L	0.513	0.12
94_I	180_Y	0.508	0.12
87_S	141_R	0.507	0.12
41_E	98_I	0.507	0.12
37_Q	135_R	0.502	0.11
12_V	55_N	0.500	0.11
11_V	77_H	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2i5hA	1	0.8317	100	0.398	Contact Map
2eduA	1	0.4567	95.8	0.927	Contact Map
3wu2U	1	0.4519	95.1	0.93	Contact Map
3f2bA	1	0.6779	91.8	0.939	Contact Map
2duyA	1	0.3125	90.6	0.941	Contact Map
2hnhA	1	0.6971	82.2	0.948	Contact Map
2lyhA	1	0.3221	79.2	0.949	Contact Map
2hpiA	2	0.7548	72.3	0.952	Contact Map
4pj0U	1	0.4231	69.6	0.953	Contact Map
3b0xA	1	0.8269	63.3	0.955	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.