Q7LXJ9 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXJ9 - Uncharacterized protein

UniProt:	Q7LXJ9	Sequences: MNSESIYSMRVVSSAFKNEDFIPIKYTCDGQDLSPELEWDLVTNAKSYAIIVEDPDAPGGTFIHWVIYNITTNRLPEGVPRLYKSQYGVQGVNDFGNIGYNGPCPPKTHPPHRYYFYVYAIDTILLEIKNINADKLKSLMEGHGIERGFVMGKYKRK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	157 (145)
Sequences:	2607 (1840)
Seq/√Len:	152.8

ECOLI - YBCL YBHB
BACSU - YXKA
HALSA - Q9HND1
SULSO - Q7LXJ9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
122_D	143_H	4.720	1.00
41_L	48_Y	3.980	1.00
28_C	104_C	3.564	1.00
95_F	101_N	2.771	1.00
52_V	116_F	2.645	1.00
50_I	118_V	2.554	1.00
25_K	77_E	2.513	1.00
9_M	148_G	2.433	1.00
21_F	153_K	2.314	1.00
14_S	36_E	2.232	1.00
46_K	124_I	2.094	1.00
69_N	126_L	2.077	1.00
15_A	77_E	2.067	1.00
15_A	36_E	2.001	1.00
115_Y	151_M	1.898	1.00
17_K	20_D	1.878	1.00
117_Y	149_F	1.847	1.00
49_A	136_L	1.763	1.00
16_F	152_G	1.760	1.00
41_L	73_N	1.730	1.00
69_N	125_L	1.674	1.00
32_D	102_G	1.639	1.00
48_Y	72_T	1.620	1.00
11_V	118_V	1.619	1.00
121_I	140_M	1.612	1.00
25_K	31_Q	1.588	1.00
68_Y	91_G	1.563	1.00
34_S	75_L	1.532	1.00
91_G	136_L	1.488	1.00
22_I	103_P	1.458	1.00
110_P	155_K	1.451	1.00
36_E	74_R	1.446	1.00
111_P	155_K	1.411	1.00
38_E	74_R	1.388	1.00
67_I	88_G	1.369	1.00
49_A	140_M	1.362	1.00
117_Y	147_R	1.333	1.00
42_V	45_A	1.333	1.00
56_D	113_R	1.330	1.00
13_S	150_V	1.320	1.00
11_V	148_G	1.281	1.00
85_S	88_G	1.275	1.00
47_S	69_N	1.274	1.00
136_L	140_M	1.266	1.00
16_F	23_P	1.259	1.00
78_G	81_R	1.236	1.00
66_V	91_G	1.227	1.00
47_S	123_T	1.213	1.00
68_Y	136_L	1.210	1.00
39_W	75_L	1.205	1.00
22_I	152_G	1.199	1.00
21_F	155_K	1.193	1.00
54_D	64_H	1.188	1.00
63_I	133_A	1.185	1.00
139_L	142_G	1.162	1.00
123_T	143_H	1.155	1.00
132_N	135_K	1.150	1.00
13_S	37_L	1.147	1.00
76_P	79_V	1.137	1.00
140_M	144_G	1.132	1.00
42_V	120_A	1.132	1.00
11_V	37_L	1.104	0.99
10_R	40_D	1.094	0.99
119_Y	140_M	1.090	0.99
68_Y	131_I	1.084	0.99
25_K	33_L	1.069	0.99
80_P	90_Q	1.069	0.99
115_Y	149_F	1.058	0.99
66_V	136_L	1.048	0.99
100_Y	103_P	1.042	0.99
90_Q	99_G	1.042	0.99
14_S	38_E	1.039	0.99
48_Y	73_N	1.013	0.99
62_F	95_F	0.999	0.99
9_M	146_E	0.996	0.99
49_A	121_I	0.990	0.99
42_V	48_Y	0.983	0.99
64_H	112_H	0.964	0.99
53_E	63_I	0.959	0.98
18_N	151_M	0.945	0.98
69_N	89_V	0.944	0.98
64_H	105_P	0.940	0.98
48_Y	118_V	0.939	0.98
26_Y	77_E	0.932	0.98
53_E	61_T	0.932	0.98
45_A	48_Y	0.926	0.98
44_N	145_I	0.918	0.98
33_L	77_E	0.914	0.98
34_S	65_W	0.913	0.98
47_S	124_I	0.909	0.98
61_T	134_D	0.908	0.98
119_Y	144_G	0.905	0.98
53_E	117_Y	0.902	0.98
26_Y	36_E	0.902	0.98
41_L	44_N	0.896	0.98
118_V	148_G	0.892	0.98
105_P	112_H	0.887	0.97
45_A	145_I	0.886	0.97
35_P	116_F	0.882	0.97
22_I	26_Y	0.877	0.97
47_S	125_L	0.876	0.97
9_M	41_L	0.875	0.97
54_D	112_H	0.868	0.97
60_G	137_K	0.858	0.97
24_I	29_D	0.850	0.97
113_R	151_M	0.848	0.97
131_I	136_L	0.846	0.97
68_Y	89_V	0.845	0.97
45_A	120_A	0.845	0.97
11_V	150_V	0.845	0.97
52_V	100_Y	0.831	0.96
27_T	154_Y	0.827	0.96
19_E	151_M	0.820	0.96
55_P	115_Y	0.812	0.96
21_F	24_I	0.812	0.96
40_D	73_N	0.790	0.95
12_V	38_E	0.787	0.95
39_W	48_Y	0.782	0.95
44_N	146_E	0.777	0.95
98_I	130_N	0.777	0.95
34_S	79_V	0.768	0.94
16_F	20_D	0.767	0.94
12_V	40_D	0.764	0.94
21_F	111_P	0.762	0.94
135_K	139_L	0.747	0.93
135_K	138_S	0.737	0.93
15_A	26_Y	0.735	0.93
92_V	130_N	0.732	0.93
65_W	80_P	0.731	0.93
65_W	90_Q	0.729	0.92
41_L	45_A	0.725	0.92
122_D	144_G	0.719	0.92
16_F	150_V	0.719	0.92
32_D	101_N	0.718	0.92
32_D	95_F	0.718	0.92
120_A	145_I	0.707	0.91
54_D	105_P	0.700	0.91
131_I	135_K	0.699	0.91
51_I	140_M	0.682	0.90
107_K	111_P	0.680	0.90
28_C	101_N	0.672	0.89
62_F	101_N	0.671	0.89
13_S	16_F	0.668	0.89
67_I	90_Q	0.665	0.89
92_V	96_G	0.657	0.88
93_N	101_N	0.655	0.88
37_L	116_F	0.655	0.88
144_G	147_R	0.651	0.87
57_A	62_F	0.651	0.87
38_E	73_N	0.651	0.87
37_L	50_I	0.648	0.87
67_I	70_I	0.647	0.87
80_P	84_K	0.644	0.87
62_F	106_P	0.634	0.86
37_L	150_V	0.634	0.86
66_V	133_A	0.633	0.86
19_E	153_K	0.632	0.86
91_G	133_A	0.627	0.85
32_D	97_N	0.624	0.85
20_D	153_K	0.623	0.85
54_D	57_A	0.621	0.85
56_D	112_H	0.620	0.85
16_F	22_I	0.620	0.85
133_A	137_K	0.618	0.85
111_P	153_K	0.617	0.85
141_E	147_R	0.617	0.85
53_E	133_A	0.614	0.84
69_N	123_T	0.613	0.84
62_F	138_S	0.607	0.84
24_I	27_T	0.602	0.83
97_N	101_N	0.600	0.83
14_S	74_R	0.599	0.83
50_I	70_I	0.593	0.82
23_P	26_Y	0.590	0.82
24_I	31_Q	0.589	0.82
53_E	137_K	0.587	0.82
127_E	136_L	0.585	0.81
57_A	94_D	0.584	0.81
140_M	143_H	0.584	0.81
92_V	98_I	0.577	0.80
39_W	118_V	0.575	0.80
23_P	27_T	0.575	0.80
64_H	106_P	0.575	0.80
81_R	90_Q	0.573	0.80
21_F	27_T	0.573	0.80
39_W	68_Y	0.570	0.80
62_F	135_K	0.569	0.80
53_E	115_Y	0.568	0.79
33_L	78_G	0.565	0.79
93_N	97_N	0.562	0.79
28_C	32_D	0.560	0.78
41_L	146_E	0.557	0.78
127_E	131_I	0.554	0.78
128_I	131_I	0.552	0.77
18_N	150_V	0.552	0.77
29_D	154_Y	0.551	0.77
49_A	119_Y	0.549	0.77
106_P	112_H	0.549	0.77
22_I	27_T	0.548	0.77
105_P	108_T	0.545	0.77
62_F	94_D	0.535	0.75
22_I	25_K	0.531	0.75
61_T	137_K	0.530	0.75
51_I	133_A	0.526	0.74
98_I	129_K	0.526	0.74
42_V	146_E	0.526	0.74
122_D	145_I	0.524	0.74
90_Q	98_I	0.519	0.73
117_Y	137_K	0.516	0.73
89_V	129_K	0.514	0.72
94_D	101_N	0.513	0.72
67_I	80_P	0.509	0.72
39_W	146_E	0.508	0.71
56_D	64_H	0.507	0.71
118_V	147_R	0.507	0.71
62_F	93_N	0.504	0.71
11_V	50_I	0.502	0.71
47_S	72_T	0.500	0.70

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3n08A	2	0.9236	100	0.188	Contact Map
1fuxA	2	0.9618	100	0.189	Contact Map
1fjjA	2	0.9363	100	0.205	Contact Map
4begA	4	1	100	0.206	Contact Map
2evvA	2	0.9299	100	0.237	Contact Map
1wpxB	1	0.9172	99.9	0.533	Contact Map
2iqyA	1	0.8726	99.9	0.566	Contact Map
2gzqA	1	0.8981	99.9	0.566	Contact Map
3axyA	1	0.8471	99.9	0.569	Contact Map
2jyzA	1	0.879	99.9	0.569	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.