Q7LXI8 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXI8 - Uncharacterized protein

UniProt:	Q7LXI8	Sequences: MGLLLVDIGMKKLYSVKVRILHKGCWTEKIKQYKIRTIKISPYGSKRVKVIIASPSHQIIKDLKESENVNEVIKYRKLNGGYLIEFSEDKDNTIAGMLLEFEDKILNYSNVINKGVEFWDFVATSKGVINSLKERFGIEDIEVKGVSLDKFLGNALTEKEVLILKIALNMGYFNYPRNIKAKDIAEILGISKQDFLYHLRNSINKIITSIDLDK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	214 (194)
Sequences:	1791 (1478)
Seq/√Len:	106.1

HALSA - Q9HSM9 Q9HR58 O54637 Q9HSR5 Q9HPS7 Q9HQD9 DMSR Q9HQU9
SULSO - Q7LXI8 Q97YT8 Q97ZB6 Q97YL7 Q97WR0 Q97UD7 Q97Y14 Q97UC0 Q97X87 Q97ZX5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
173_F	203_I	3.798	1.00
179_I	184_I	3.719	1.00
166_I	170_M	3.502	1.00
145_G	148_L	3.350	1.00
129_I	136_F	2.995	1.00
163_I	188_L	2.956	1.00
194_D	198_H	2.951	1.00
191_S	194_D	2.808	1.00
166_I	184_I	2.775	1.00
170_M	187_I	2.756	1.00
170_M	184_I	2.666	1.00
180_K	183_D	2.609	1.00
179_I	183_D	2.599	1.00
105_I	123_A	2.572	1.00
168_L	208_T	2.567	1.00
98_L	105_I	2.491	1.00
159_K	198_H	2.342	1.00
174_N	178_N	2.300	1.00
181_A	195_F	2.240	1.00
159_K	162_L	2.217	1.00
139_E	145_G	2.201	1.00
131_S	136_F	2.152	1.00
141_I	145_G	2.079	1.00
175_Y	196_L	2.014	1.00
129_I	135_R	1.994	1.00
143_V	146_V	1.966	1.00
131_S	135_R	1.860	1.00
19_R	116_V	1.829	1.00
161_V	165_K	1.774	1.00
181_A	196_L	1.750	1.00
177_R	200_R	1.728	1.00
164_L	207_I	1.711	1.00
159_K	163_I	1.626	1.00
192_K	196_L	1.624	1.00
198_H	201_N	1.616	1.00
50_V	86_F	1.567	1.00
128_V	131_S	1.556	1.00
198_H	205_K	1.528	1.00
184_I	195_F	1.525	1.00
190_I	195_F	1.472	1.00
60_I	84_I	1.467	1.00
39_K	42_P	1.457	1.00
136_F	141_I	1.440	1.00
108_Y	122_V	1.439	1.00
207_I	210_I	1.415	1.00
18_V	121_F	1.407	1.00
197_Y	201_N	1.400	1.00
139_E	143_V	1.386	1.00
74_K	84_I	1.380	1.00
139_E	146_V	1.378	1.00
69_V	72_V	1.359	1.00
52_I	59_I	1.344	0.99
163_I	198_H	1.344	0.99
73_I	179_I	1.331	0.99
153_G	210_I	1.327	0.99
181_A	198_H	1.326	0.99
143_V	148_L	1.310	0.99
30_I	66_S	1.298	0.99
138_I	145_G	1.288	0.99
164_L	173_F	1.260	0.99
171_G	178_N	1.214	0.99
138_I	143_V	1.207	0.99
75_Y	83_L	1.196	0.99
129_I	143_V	1.188	0.99
206_I	210_I	1.175	0.99
129_I	133_K	1.165	0.99
128_V	132_L	1.165	0.99
179_I	187_I	1.164	0.99
183_D	186_E	1.160	0.98
139_E	148_L	1.156	0.98
186_E	189_G	1.150	0.98
163_I	184_I	1.137	0.98
136_F	139_E	1.137	0.98
81_G	158_E	1.110	0.98
74_K	82_Y	1.110	0.98
136_F	145_G	1.109	0.98
173_F	199_L	1.104	0.98
75_Y	112_I	1.095	0.98
172_Y	177_R	1.091	0.98
133_K	136_F	1.087	0.98
37_T	52_I	1.086	0.98
175_Y	193_Q	1.076	0.98
146_V	149_D	1.069	0.97
126_K	191_S	1.062	0.97
194_D	199_L	1.056	0.97
138_I	146_V	1.055	0.97
68_N	157_T	1.044	0.97
175_Y	197_Y	1.042	0.97
170_M	179_I	1.042	0.97
168_L	211_D	1.028	0.97
163_I	190_I	1.021	0.97
136_F	143_V	1.010	0.96
129_I	145_G	1.009	0.96
51_I	120_D	0.995	0.96
16_V	19_R	0.985	0.96
132_L	136_F	0.980	0.96
58_Q	61_K	0.979	0.96
175_Y	204_N	0.974	0.96
191_S	200_R	0.973	0.96
138_I	148_L	0.967	0.95
199_L	203_I	0.965	0.95
194_D	197_Y	0.961	0.95
156_L	202_S	0.961	0.95
52_I	82_Y	0.957	0.95
105_I	109_S	0.955	0.95
163_I	202_S	0.948	0.95
185_A	195_F	0.948	0.95
70_N	89_D	0.947	0.95
181_A	192_K	0.937	0.95
109_S	173_F	0.936	0.94
193_Q	197_Y	0.925	0.94
93_T	96_G	0.924	0.94
128_V	145_G	0.912	0.94
58_Q	186_E	0.912	0.94
172_Y	181_A	0.911	0.94
96_G	140_D	0.906	0.93
182_K	192_K	0.902	0.93
39_K	50_V	0.899	0.93
71_E	74_K	0.899	0.93
111_V	118_F	0.898	0.93
175_Y	198_H	0.897	0.93
192_K	201_N	0.895	0.93
175_Y	200_R	0.895	0.93
53_A	81_G	0.888	0.93
184_I	188_L	0.884	0.93
42_P	162_L	0.877	0.92
168_L	173_F	0.870	0.92
130_N	133_K	0.866	0.92
129_I	132_L	0.862	0.92
174_N	204_N	0.858	0.91
51_I	83_L	0.844	0.91
165_K	169_N	0.843	0.91
39_K	44_G	0.840	0.91
113_N	116_V	0.838	0.90
48_V	88_E	0.835	0.90
129_I	146_V	0.834	0.90
159_K	203_I	0.831	0.90
176_P	200_R	0.831	0.90
132_L	139_E	0.829	0.90
138_I	144_K	0.828	0.90
127_G	130_N	0.827	0.90
26_W	30_I	0.818	0.89
15_S	110_N	0.816	0.89
65_E	80_G	0.815	0.89
105_I	108_Y	0.813	0.89
162_L	165_K	0.812	0.89
166_I	187_I	0.808	0.89
66_S	69_V	0.808	0.89
140_D	146_V	0.805	0.89
17_K	118_F	0.802	0.88
82_Y	85_E	0.799	0.88
16_V	126_K	0.786	0.87
201_N	204_N	0.778	0.87
139_E	147_S	0.778	0.87
58_Q	62_D	0.774	0.87
128_V	136_F	0.769	0.86
39_K	122_V	0.766	0.86
159_K	197_Y	0.763	0.86
204_N	208_T	0.761	0.86
140_D	145_G	0.755	0.85
40_I	51_I	0.754	0.85
48_V	51_I	0.754	0.85
29_K	94_I	0.748	0.85
23_K	28_E	0.735	0.84
22_H	25_C	0.734	0.84
87_S	192_K	0.724	0.83
135_R	139_E	0.721	0.83
155_A	209_S	0.720	0.82
140_D	143_V	0.719	0.82
157_T	205_K	0.713	0.82
181_A	194_D	0.703	0.81
24_G	190_I	0.703	0.81
53_A	96_G	0.702	0.81
38_I	41_S	0.698	0.80
110_N	119_W	0.696	0.80
57_H	60_I	0.696	0.80
18_V	119_W	0.692	0.80
112_I	117_E	0.689	0.80
175_Y	182_K	0.684	0.79
95_A	202_S	0.684	0.79
18_V	39_K	0.678	0.79
122_V	173_F	0.674	0.78
206_I	209_S	0.673	0.78
36_R	94_I	0.673	0.78
73_I	85_E	0.664	0.77
130_N	178_N	0.660	0.77
132_L	137_G	0.659	0.77
173_F	181_A	0.659	0.77
180_K	208_T	0.658	0.76
194_D	202_S	0.657	0.76
125_S	208_T	0.652	0.76
132_L	135_R	0.651	0.76
129_I	137_G	0.651	0.76
140_D	148_L	0.651	0.76
63_L	202_S	0.651	0.76
31_K	172_Y	0.650	0.76
29_K	32_Q	0.649	0.75
162_L	166_I	0.648	0.75
60_I	72_V	0.645	0.75
135_R	143_V	0.643	0.75
60_I	63_L	0.639	0.74
173_F	202_S	0.616	0.72
91_D	173_F	0.608	0.71
25_C	28_E	0.603	0.70
98_L	121_F	0.602	0.70
95_A	107_N	0.597	0.69
18_V	21_L	0.595	0.69
95_A	195_F	0.590	0.68
93_T	105_I	0.589	0.68
68_N	203_I	0.585	0.68
96_G	100_E	0.584	0.68
142_E	145_G	0.584	0.68
182_K	200_R	0.583	0.67
92_N	173_F	0.583	0.67
175_Y	194_D	0.582	0.67
166_I	188_L	0.578	0.67
135_R	138_I	0.576	0.67
194_D	210_I	0.575	0.66
28_E	35_I	0.572	0.66
109_S	203_I	0.571	0.66
108_Y	193_Q	0.570	0.66
144_K	148_L	0.569	0.66
161_V	209_S	0.567	0.65
62_D	69_V	0.566	0.65
171_G	174_N	0.566	0.65
164_L	203_I	0.564	0.65
133_K	137_G	0.564	0.65
107_N	163_I	0.564	0.65
118_F	187_I	0.558	0.64
131_S	134_E	0.555	0.64
81_G	89_D	0.554	0.64
53_A	97_M	0.553	0.63
21_L	28_E	0.552	0.63
39_K	181_A	0.552	0.63
207_I	211_D	0.551	0.63
92_N	98_L	0.550	0.63
94_I	104_K	0.550	0.63
72_V	75_Y	0.550	0.63
140_D	169_N	0.548	0.63
201_N	206_I	0.544	0.62
26_W	63_L	0.544	0.62
29_K	68_N	0.543	0.62
38_I	142_E	0.540	0.62
133_K	141_I	0.537	0.61
152_L	206_I	0.536	0.61
16_V	121_F	0.535	0.61
128_V	134_E	0.535	0.61
181_A	202_S	0.534	0.61
173_F	207_I	0.534	0.61
188_L	196_L	0.534	0.61
161_V	210_I	0.534	0.61
134_E	137_G	0.533	0.61
53_A	58_Q	0.532	0.60
153_G	161_V	0.532	0.60
165_K	211_D	0.531	0.60
25_C	117_E	0.530	0.60
166_I	179_I	0.530	0.60
64_K	74_K	0.529	0.60
79_N	168_L	0.528	0.60
92_N	180_K	0.524	0.59
23_K	26_W	0.524	0.59
55_P	170_M	0.523	0.59
135_R	144_K	0.523	0.59
19_R	36_R	0.521	0.59
40_I	43_Y	0.519	0.59
153_G	174_N	0.517	0.58
25_C	119_W	0.517	0.58
139_E	142_E	0.516	0.58
130_N	189_G	0.515	0.58
65_E	100_E	0.514	0.58
81_G	84_I	0.513	0.58
142_E	146_V	0.513	0.58
52_I	107_N	0.513	0.58
73_I	125_S	0.512	0.58
124_T	187_I	0.512	0.58
55_P	80_G	0.511	0.57
172_Y	180_K	0.511	0.57
35_I	57_H	0.510	0.57
21_L	205_K	0.508	0.57
120_D	144_K	0.507	0.57
182_K	186_E	0.506	0.57
22_H	119_W	0.506	0.57
89_D	189_G	0.506	0.57
104_K	109_S	0.505	0.57
155_A	208_T	0.504	0.56
85_E	190_I	0.503	0.56
33_Y	54_S	0.503	0.56
202_S	207_I	0.502	0.56
135_R	146_V	0.500	0.56
128_V	135_R	0.500	0.56
129_I	144_K	0.500	0.56

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ku3A	1	0.285	97.7	0.841	Contact Map
2o8xA	7	0.285	97.6	0.844	Contact Map
1s7oA	3	0.3271	97.5	0.845	Contact Map
4wszA	2	0.2617	97.5	0.846	Contact Map
1xsvA	2	0.3224	97.4	0.85	Contact Map
3c57A	2	0.2383	97.3	0.852	Contact Map
3t72q	1	0.3505	97.2	0.854	Contact Map
1je8A	2	0.2664	97.2	0.854	Contact Map
1x3uA	1	0.3131	97.2	0.854	Contact Map
1fseA	2	0.271	97.1	0.855	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.