Q7LXG9 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXG9 - Uncharacterized protein

UniProt:	Q7LXG9	Sequences: MESKIPAIEKHRDAYVKIRIIESLDELALGLKLLKEGFSRNSANKVFQSWKAIISALTVINLEKMPRNEKEKEWYYKSGFLAPTTGLKGISQRLEELGYKVNSLTSVALELHRYAYNGLYKGASDYYEREEAINDIIYLSKEIMKVIKEFFKEYWDEEIEEHYNLAEKELMK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	172 (145)
Sequences:	163 (124)
Seq/√Len:	10.3

SULSO - Q7LXG9 Q97YE3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
126_Y	135_D	4.784	1.00
54_I	87_L	4.424	0.99
50_W	105_T	3.872	0.99
82_A	90_I	3.678	0.98
47_F	84_T	3.490	0.97
119_L	132_A	3.279	0.96
114_Y	132_A	3.137	0.95
32_K	36_E	2.864	0.92
113_R	125_D	2.512	0.85
114_Y	119_L	2.467	0.84
79_G	87_L	2.383	0.82
62_L	76_Y	2.380	0.81
106_S	110_E	2.358	0.81
114_Y	129_R	2.206	0.76
58_T	90_I	2.151	0.74
50_W	132_A	2.119	0.73
11_H	14_A	2.079	0.72
58_T	82_A	2.075	0.71
55_S	82_A	1.957	0.67
31_L	144_M	1.868	0.63
19_R	43_A	1.847	0.62
105_T	139_L	1.818	0.61
129_R	132_A	1.816	0.61
44_N	115_A	1.805	0.60
50_W	139_L	1.668	0.54
111_L	135_D	1.590	0.50
88_K	135_D	1.559	0.49
20_I	137_I	1.512	0.47
24_L	147_I	1.511	0.47
89_G	128_E	1.485	0.45
51_K	100_K	1.469	0.45
53_I	101_V	1.436	0.43
39_S	114_Y	1.416	0.42
65_M	75_Y	1.397	0.41
132_A	139_L	1.386	0.41
55_S	90_I	1.381	0.41
60_I	75_Y	1.353	0.39
140_S	147_I	1.350	0.39
26_E	34_L	1.312	0.38
4_K	121_K	1.305	0.37
54_I	84_T	1.291	0.37
88_K	126_Y	1.286	0.36
119_L	129_R	1.279	0.36
14_A	17_K	1.246	0.35
76_Y	140_S	1.221	0.34
42_S	48_Q	1.215	0.33
95_E	100_K	1.190	0.32
105_T	132_A	1.189	0.32
40_R	124_S	1.187	0.32
144_M	147_I	1.118	0.30
33_L	77_K	1.110	0.29
30_G	120_Y	1.105	0.29
50_W	119_L	1.103	0.29
49_S	130_E	1.091	0.29
70_K	123_A	1.089	0.28
119_L	133_I	1.079	0.28
84_T	87_L	1.076	0.28
40_R	43_A	1.068	0.28
8_I	55_S	1.058	0.27
39_S	129_R	1.055	0.27
33_L	38_F	1.013	0.26
27_L	136_I	1.012	0.26
46_V	91_S	1.008	0.25
15_Y	56_A	1.004	0.25
74_W	131_E	1.003	0.25
16_V	60_I	1.002	0.25
61_N	64_K	1.001	0.25
30_G	42_S	0.989	0.25
5_I	114_Y	0.977	0.24
88_K	92_Q	0.977	0.24
73_E	98_G	0.963	0.24
31_L	71_E	0.956	0.24
33_L	80_F	0.945	0.23
88_K	110_E	0.936	0.23
54_I	94_L	0.931	0.23
78_S	130_E	0.923	0.23
133_I	137_I	0.922	0.23
12_R	59_V	0.914	0.22
62_L	75_Y	0.905	0.22
18_I	121_K	0.902	0.22
94_L	139_L	0.898	0.22
19_R	65_M	0.895	0.22
28_A	38_F	0.880	0.21
26_E	48_Q	0.875	0.21
143_I	146_V	0.868	0.21
52_A	111_L	0.853	0.20
50_W	114_Y	0.844	0.20
53_I	92_Q	0.826	0.20
108_A	130_E	0.817	0.19
31_L	140_S	0.814	0.19
41_N	51_K	0.804	0.19
34_L	52_A	0.804	0.19
32_K	46_V	0.798	0.19
59_V	62_L	0.796	0.19
66_P	129_R	0.796	0.19
16_V	29_L	0.796	0.19
14_A	66_P	0.794	0.19
142_E	145_K	0.780	0.18
110_E	125_D	0.775	0.18
71_E	136_I	0.771	0.18
13_D	87_L	0.771	0.18
8_I	115_A	0.768	0.18
103_S	107_V	0.764	0.18
11_H	17_K	0.764	0.18
79_G	97_L	0.760	0.18
119_L	127_Y	0.759	0.18
127_Y	145_K	0.752	0.17
27_L	38_F	0.748	0.17
25_D	28_A	0.737	0.17
5_I	8_I	0.734	0.17
63_E	101_V	0.733	0.17
19_R	22_E	0.731	0.17
69_E	144_M	0.728	0.17
44_N	48_Q	0.726	0.17
142_E	146_V	0.726	0.17
86_G	110_E	0.725	0.17
40_R	44_N	0.725	0.17
25_D	121_K	0.723	0.17
12_R	47_F	0.723	0.17
85_T	140_S	0.716	0.17
86_G	127_Y	0.714	0.16
41_N	45_K	0.714	0.16
48_Q	115_A	0.708	0.16
54_I	57_L	0.705	0.16
56_A	84_T	0.699	0.16
99_Y	131_E	0.699	0.16
28_A	77_K	0.692	0.16
23_S	55_S	0.692	0.16
40_R	48_Q	0.687	0.16
18_I	78_S	0.686	0.16
17_K	99_Y	0.684	0.16
15_Y	98_G	0.681	0.16
45_K	150_F	0.680	0.16
90_I	147_I	0.680	0.16
101_V	144_M	0.677	0.16
48_Q	124_S	0.674	0.15
49_S	115_A	0.668	0.15
41_N	135_D	0.667	0.15
29_L	125_D	0.666	0.15
77_K	113_R	0.665	0.15
34_L	85_T	0.665	0.15
52_A	63_E	0.658	0.15
86_G	139_L	0.645	0.15
73_E	77_K	0.639	0.15
44_N	65_M	0.638	0.15
99_Y	106_S	0.635	0.15
75_Y	113_R	0.634	0.15
30_G	143_I	0.633	0.15
48_Q	58_T	0.627	0.14
13_D	20_I	0.626	0.14
35_K	76_Y	0.623	0.14
90_I	125_D	0.623	0.14
88_K	107_V	0.620	0.14
75_Y	80_F	0.619	0.14
11_H	80_F	0.619	0.14
18_I	119_L	0.618	0.14
122_G	127_Y	0.618	0.14
95_E	102_N	0.611	0.14
62_L	79_G	0.607	0.14
14_A	101_V	0.605	0.14
51_K	113_R	0.597	0.14
23_S	150_F	0.595	0.14
87_L	101_V	0.592	0.14
31_L	47_F	0.591	0.14
13_D	97_L	0.588	0.14
6_P	50_W	0.587	0.13
39_S	97_L	0.587	0.13
41_N	49_S	0.586	0.13
84_T	121_K	0.585	0.13
44_N	124_S	0.585	0.13
22_E	40_R	0.583	0.13
28_A	90_I	0.582	0.13
105_T	138_Y	0.571	0.13
23_S	76_Y	0.571	0.13
17_K	91_S	0.565	0.13
84_T	94_L	0.563	0.13
26_E	42_S	0.563	0.13
17_K	78_S	0.561	0.13
89_G	127_Y	0.560	0.13
50_W	102_N	0.559	0.13
51_K	130_E	0.559	0.13
79_G	89_G	0.557	0.13
100_K	150_F	0.557	0.13
52_A	98_G	0.555	0.13
7_A	49_S	0.552	0.13
96_E	130_E	0.550	0.13
72_K	77_K	0.550	0.13
103_S	106_S	0.547	0.13
8_I	48_Q	0.541	0.13
73_E	139_L	0.541	0.13
63_E	73_E	0.540	0.12
16_V	72_K	0.538	0.12
14_A	21_I	0.538	0.12
53_I	135_D	0.535	0.12
24_L	140_S	0.535	0.12
24_L	148_K	0.533	0.12
88_K	106_S	0.528	0.12
68_N	147_I	0.525	0.12
35_K	67_R	0.523	0.12
113_R	137_I	0.522	0.12
105_T	114_Y	0.518	0.12
18_I	143_I	0.518	0.12
114_Y	133_I	0.518	0.12
111_L	125_D	0.516	0.12
4_K	72_K	0.514	0.12
68_N	141_K	0.511	0.12
43_A	54_I	0.509	0.12
23_S	30_G	0.509	0.12
16_V	25_D	0.508	0.12
43_A	65_M	0.508	0.12
22_E	43_A	0.507	0.12
26_E	132_A	0.507	0.12
13_D	16_V	0.506	0.12
52_A	95_E	0.506	0.12
4_K	25_D	0.505	0.12
86_G	89_G	0.505	0.12
51_K	112_H	0.502	0.12
21_I	61_N	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3o10A	2	0.75	90	0.926	Contact Map
2hsbA	2	0.7035	86	0.931	Contact Map
4j4rA	3	0.5174	83.5	0.933	Contact Map
2jpuA	1	0.7326	74.2	0.939	Contact Map
4j4wA	3	0.4884	66.2	0.942	Contact Map
1wolA	1	0.6919	65	0.943	Contact Map
3ov9A	3	0.4709	61.4	0.944	Contact Map
4j4yA	4	0.4942	58.7	0.945	Contact Map
4nqfA	2	0.7791	55	0.946	Contact Map
1ufbA	3	0.6977	52.7	0.947	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.