Q7LXF9 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXF9 - Uncharacterized protein

UniProt:	Q7LXF9	Sequences: MEFIPPKRLLELIRQYSTTFENWHSVMLSIYLHKERIKCKLRNGQLLYLKPNEIVLLAGLKIVELNEDSVRFQFNGREICLKGWKLSYPGDSFSDYWRIDVRGKRVLDIGAGIGDSPIYFSIAGAKEVVAVEVDSKKVELMRENLKANSINNVIVVDKGVGIKDDENYISWPKLISNYGPFDVAKIDCDGCEKIIVPYIKEIPSLLIEWDYNYKDIVSNLTKNGYKVKVEHTLKNLGFIYAKKR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	244 (200)
Sequences:	303 (289)
Seq/√Len:	20.5

HALSA - Q9HQP5
SULSO - Q7LXF9 Q97XT4 Q7LXF6 Q7LXE9 Q97XU3 Q97X54 Q97XG4 Q7LXG2 Q7LXE1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
188_C	195_I	5.156	1.00
131_V	174_L	4.134	1.00
204_S	225_Y	4.022	1.00
186_I	195_I	3.298	1.00
116_S	120_F	3.244	1.00
162_I	194_I	3.179	1.00
117_P	153_V	3.111	0.99
138_V	155_V	2.846	0.99
109_I	160_V	2.709	0.99
161_G	191_C	2.685	0.98
116_S	210_D	2.665	0.98
111_A	141_M	2.553	0.98
188_C	191_C	2.411	0.97
109_I	188_C	2.381	0.97
138_V	157_D	2.368	0.97
164_D	173_K	2.348	0.96
106_V	128_V	2.325	0.96
96_Y	210_D	2.252	0.95
189_D	210_D	2.198	0.95
143_E	146_K	2.160	0.94
197_P	201_E	2.125	0.94
172_P	184_A	2.081	0.93
138_V	142_R	2.038	0.92
112_G	115_D	2.025	0.92
199_I	204_S	2.016	0.92
112_G	208_E	1.968	0.91
208_E	229_V	1.912	0.89
111_A	130_A	1.890	0.89
193_K	225_Y	1.821	0.87
109_I	195_I	1.749	0.84
171_W	198_Y	1.704	0.83
172_P	188_C	1.685	0.82
118_I	144_N	1.666	0.81
115_D	225_Y	1.665	0.81
170_S	173_K	1.628	0.80
205_L	214_K	1.592	0.78
172_P	225_Y	1.557	0.77
205_L	208_E	1.550	0.76
205_L	232_T	1.549	0.76
103_G	126_K	1.544	0.76
202_I	225_Y	1.512	0.75
196_V	200_K	1.500	0.74
131_V	160_V	1.493	0.74
160_V	170_S	1.492	0.74
104_K	126_K	1.489	0.73
142_R	155_V	1.447	0.71
171_W	175_I	1.408	0.69
208_E	214_K	1.408	0.69
184_A	204_S	1.385	0.68
108_D	185_K	1.373	0.67
144_N	208_E	1.362	0.66
199_I	202_I	1.341	0.65
124_G	128_V	1.335	0.65
172_P	204_S	1.324	0.64
212_N	220_L	1.280	0.61
186_I	205_L	1.265	0.60
104_K	182_D	1.260	0.60
116_S	209_W	1.252	0.60
107_L	160_V	1.250	0.60
107_L	210_D	1.250	0.60
154_I	180_P	1.250	0.60
111_A	155_V	1.244	0.59
172_P	199_I	1.222	0.58
172_P	198_Y	1.202	0.56
135_S	157_D	1.195	0.56
145_L	155_V	1.180	0.55
65_L	68_D	1.172	0.55
144_N	148_N	1.167	0.54
142_R	158_K	1.161	0.54
217_V	221_T	1.158	0.54
113_I	130_A	1.151	0.53
121_S	128_V	1.146	0.53
199_I	214_K	1.116	0.51
112_G	137_K	1.110	0.50
115_D	120_F	1.104	0.50
112_G	116_S	1.083	0.49
134_D	169_I	1.075	0.48
36_R	39_C	1.070	0.48
159_G	213_Y	1.059	0.47
208_E	227_V	1.053	0.47
188_C	192_E	1.050	0.47
127_E	180_P	1.041	0.46
161_G	171_W	1.033	0.45
112_G	126_K	1.031	0.45
208_E	217_V	1.028	0.45
123_A	169_I	1.024	0.45
41_L	166_E	1.019	0.45
188_C	210_D	1.013	0.44
115_D	210_D	0.999	0.43
195_I	208_E	0.994	0.43
133_V	188_C	0.991	0.43
161_G	169_I	0.982	0.42
160_V	195_I	0.980	0.42
64_E	67_E	0.978	0.42
186_I	192_E	0.976	0.42
183_V	188_C	0.973	0.42
119_Y	144_N	0.967	0.41
185_K	189_D	0.966	0.41
38_K	41_L	0.964	0.41
183_V	205_L	0.957	0.41
95_D	98_R	0.955	0.40
207_I	216_I	0.948	0.40
56_L	162_I	0.946	0.40
184_A	202_I	0.936	0.39
103_G	182_D	0.936	0.39
152_N	159_G	0.930	0.39
71_R	76_G	0.930	0.39
145_L	150_I	0.925	0.39
189_D	192_E	0.923	0.38
110_G	114_G	0.922	0.38
67_E	107_L	0.922	0.38
124_G	220_L	0.910	0.38
126_K	182_D	0.909	0.38
138_V	206_L	0.904	0.37
107_L	148_N	0.894	0.37
109_I	184_A	0.887	0.36
35_E	39_C	0.882	0.36
60_L	63_V	0.871	0.35
184_A	205_L	0.866	0.35
133_V	159_G	0.865	0.35
112_G	217_V	0.865	0.35
172_P	195_I	0.863	0.35
145_L	149_S	0.861	0.35
187_D	190_G	0.857	0.34
37_I	46_L	0.855	0.34
133_V	169_I	0.843	0.34
41_L	45_Q	0.842	0.34
72_F	163_K	0.840	0.33
199_I	223_N	0.837	0.33
188_C	208_E	0.836	0.33
112_G	117_P	0.828	0.33
122_I	135_S	0.826	0.33
35_E	40_K	0.823	0.32
38_K	46_L	0.820	0.32
84_W	177_N	0.818	0.32
135_S	145_L	0.816	0.32
182_D	230_E	0.813	0.32
37_I	41_L	0.805	0.31
124_G	202_I	0.795	0.31
107_L	209_W	0.793	0.31
135_S	226_K	0.793	0.31
109_I	208_E	0.790	0.31
144_N	207_I	0.789	0.31
99_I	151_N	0.789	0.31
106_V	126_K	0.782	0.30
106_V	202_I	0.781	0.30
49_L	173_K	0.781	0.30
198_Y	218_S	0.777	0.30
183_V	204_S	0.777	0.30
89_P	93_F	0.765	0.29
59_G	63_V	0.765	0.29
144_N	147_A	0.765	0.29
67_E	122_I	0.764	0.29
113_I	144_N	0.764	0.29
167_N	195_I	0.759	0.29
133_V	141_M	0.758	0.29
118_I	122_I	0.756	0.29
156_V	174_L	0.753	0.29
38_K	48_Y	0.743	0.28
193_K	219_N	0.743	0.28
112_G	209_W	0.741	0.28
134_D	137_K	0.740	0.28
87_S	169_I	0.740	0.28
163_K	177_N	0.738	0.28
110_G	132_E	0.735	0.28
100_D	135_S	0.732	0.27
188_C	204_S	0.732	0.27
82_K	120_F	0.722	0.27
79_I	111_A	0.721	0.27
97_W	106_V	0.720	0.27
209_W	221_T	0.719	0.27
110_G	187_D	0.717	0.27
109_I	143_E	0.714	0.27
71_R	75_N	0.712	0.26
172_P	212_N	0.711	0.26
154_I	200_K	0.711	0.26
104_K	230_E	0.710	0.26
87_S	226_K	0.709	0.26
103_G	194_I	0.707	0.26
129_V	164_D	0.704	0.26
138_V	141_M	0.703	0.26
45_Q	51_P	0.701	0.26
38_K	42_R	0.701	0.26
118_I	130_A	0.700	0.26
169_I	228_K	0.700	0.26
209_W	217_V	0.693	0.25
107_L	174_L	0.687	0.25
49_L	53_E	0.687	0.25
97_W	104_K	0.685	0.25
102_R	177_N	0.683	0.25
129_V	174_L	0.681	0.25
166_E	173_K	0.678	0.25
138_V	164_D	0.676	0.25
187_D	192_E	0.675	0.25
108_D	145_L	0.673	0.24
209_W	216_I	0.672	0.24
39_C	107_L	0.671	0.24
130_A	140_L	0.660	0.24
171_W	195_I	0.657	0.24
35_E	130_A	0.653	0.24
161_G	167_N	0.652	0.23
204_S	223_N	0.649	0.23
108_D	114_G	0.648	0.23
137_K	216_I	0.648	0.23
197_P	221_T	0.647	0.23
88_Y	111_A	0.644	0.23
116_S	138_V	0.642	0.23
145_L	153_V	0.641	0.23
186_I	208_E	0.635	0.23
158_K	202_I	0.633	0.23
37_I	177_N	0.628	0.22
40_K	220_L	0.626	0.22
98_R	205_L	0.626	0.22
135_S	165_D	0.621	0.22
37_I	48_Y	0.619	0.22
143_E	224_G	0.618	0.22
90_G	213_Y	0.618	0.22
120_F	152_N	0.616	0.22
35_E	44_G	0.616	0.22
122_I	224_G	0.614	0.22
184_A	195_I	0.611	0.22
188_C	216_I	0.610	0.22
62_I	149_S	0.608	0.21
118_I	148_N	0.608	0.21
128_V	217_V	0.608	0.21
189_D	209_W	0.603	0.21
228_K	231_H	0.602	0.21
36_R	52_N	0.598	0.21
146_K	222_K	0.597	0.21
131_V	223_N	0.597	0.21
81_L	140_L	0.595	0.21
119_Y	234_K	0.595	0.21
106_V	124_G	0.595	0.21
130_A	224_G	0.595	0.21
39_C	42_R	0.594	0.21
129_V	183_V	0.594	0.21
35_E	128_V	0.591	0.21
106_V	232_T	0.591	0.21
62_I	65_L	0.590	0.21
118_I	153_V	0.589	0.21
162_I	220_L	0.588	0.21
106_V	204_S	0.588	0.21
205_L	220_L	0.588	0.21
101_V	151_N	0.588	0.21
155_V	186_I	0.586	0.20
108_D	111_A	0.585	0.20
193_K	212_N	0.585	0.20
119_Y	225_Y	0.585	0.20
118_I	231_H	0.583	0.20
127_E	154_I	0.582	0.20
109_I	186_I	0.581	0.20
153_V	161_G	0.579	0.20
130_A	141_M	0.576	0.20
136_K	225_Y	0.576	0.20
79_I	176_S	0.574	0.20
175_I	198_Y	0.571	0.20
168_Y	226_K	0.570	0.20
36_R	42_R	0.569	0.20
129_V	138_V	0.568	0.20
206_L	210_D	0.565	0.20
70_V	73_Q	0.563	0.20
195_I	217_V	0.563	0.20
106_V	119_Y	0.562	0.19
103_G	106_V	0.559	0.19
102_R	159_G	0.556	0.19
175_I	213_Y	0.554	0.19
144_N	150_I	0.553	0.19
199_I	213_Y	0.552	0.19
168_Y	194_I	0.551	0.19
131_V	215_D	0.548	0.19
131_V	155_V	0.546	0.19
198_Y	204_S	0.545	0.19
117_P	148_N	0.544	0.19
211_Y	217_V	0.544	0.19
51_P	169_I	0.544	0.19
78_E	171_W	0.544	0.19
132_E	190_G	0.543	0.19
84_W	186_I	0.539	0.19
141_M	155_V	0.538	0.19
170_S	207_I	0.536	0.18
81_L	180_P	0.536	0.18
56_L	160_V	0.536	0.18
56_L	109_I	0.532	0.18
205_L	217_V	0.531	0.18
112_G	133_V	0.530	0.18
109_I	210_D	0.529	0.18
151_N	165_D	0.529	0.18
126_K	133_V	0.524	0.18
103_G	125_A	0.517	0.18
36_R	118_I	0.517	0.18
172_P	202_I	0.514	0.18
153_V	191_C	0.512	0.18
184_A	187_D	0.509	0.17
36_R	40_K	0.507	0.17
198_Y	202_I	0.506	0.17
120_F	138_V	0.505	0.17
59_G	129_V	0.505	0.17
97_W	224_G	0.503	0.17
168_Y	200_K	0.502	0.17
121_S	181_F	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2py6A	4	0.9631	100	0.539	Contact Map
3gnlA	1	0.6025	98.2	0.839	Contact Map
3kr9A	1	0.5984	98.2	0.84	Contact Map
3lecA	2	0.6107	98.2	0.84	Contact Map
2yxdA	4	0.6557	98.1	0.846	Contact Map
3opnA	1	0.6393	98	0.848	Contact Map
3k6rA	1	0.9057	98	0.849	Contact Map
3bzbA	1	0.6639	98	0.85	Contact Map
3evzA	1	0.7295	97.9	0.852	Contact Map
1l3iA	5	0.668	97.9	0.853	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.