Q7LXE5 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXE5 - dTDP-4-dehydrorhamnose 3,5 epimerase (RfbC-1)

UniProt:	Q7LXE5	Sequences: MPFDFEDLGMGVLLIKPKVFPDKRGFFLELFKATDFSKHNIPMPVQVNMSFSVRGVVRGLHYQITPKEQGKLVFVPKGKILDVAVDVRKSSPTFGKYTSAELSESNHHMLWIPPGFAHGFQALDDSLVVYFVTHNDYSPQHERCINYSYIEWPIKEIIVSDKDKQCPPLDKAEVFS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	176 (167)
Sequences:	4427 (2876)
Seq/√Len:	222.5

ECOLI - RMLC
BACSU - SPSL
SULSO - Q7LXE5 Q97X30

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
144_C	166_C	3.360	1.00
79_K	101_E	3.273	1.00
33_A	44_P	3.175	1.00
124_D	127_L	2.795	1.00
80_I	129_V	2.518	1.00
16_K	108_H	2.483	1.00
8_L	98_T	2.406	1.00
6_E	13_L	2.394	1.00
138_S	141_H	2.354	1.00
60_L	117_A	2.310	1.00
64_I	143_R	2.306	1.00
70_G	111_W	2.247	1.00
81_L	99_S	2.214	1.00
47_V	132_V	2.210	1.00
50_S	120_F	2.194	1.00
37_S	42_P	2.168	1.00
77_K	104_E	2.081	1.00
57_V	121_Q	2.077	1.00
54_R	125_D	2.011	1.00
33_A	37_S	2.006	1.00
34_T	136_D	1.993	1.00
70_G	134_H	1.976	1.00
8_L	96_K	1.963	1.00
5_F	16_K	1.963	1.00
76_P	130_Y	1.907	1.00
77_K	126_S	1.870	1.00
146_N	168_P	1.857	1.00
114_P	134_H	1.840	1.00
67_K	138_S	1.820	1.00
77_K	128_V	1.784	1.00
168_P	171_K	1.755	1.00
14_L	108_H	1.749	1.00
161_D	165_Q	1.734	1.00
51_F	128_V	1.700	1.00
79_K	124_D	1.699	1.00
49_M	128_V	1.632	1.00
103_S	106_N	1.614	1.00
161_D	164_K	1.609	1.00
70_G	114_P	1.589	1.00
81_L	153_P	1.583	1.00
9_G	116_F	1.580	1.00
87_V	117_A	1.573	1.00
14_L	100_A	1.559	1.00
67_K	135_N	1.538	1.00
62_Y	143_R	1.519	1.00
12_V	84_A	1.480	1.00
34_T	38_K	1.478	1.00
79_K	103_S	1.476	1.00
49_M	74_F	1.471	1.00
60_L	119_G	1.467	1.00
19_V	107_H	1.385	1.00
122_A	127_L	1.366	1.00
6_E	10_M	1.344	1.00
7_D	14_L	1.318	1.00
80_I	127_L	1.303	1.00
43_M	111_W	1.283	1.00
62_Y	172_A	1.263	1.00
67_K	141_H	1.249	1.00
26_F	51_F	1.240	1.00
32_K	35_D	1.221	1.00
114_P	135_N	1.215	1.00
12_V	98_T	1.206	1.00
57_V	157_I	1.203	1.00
121_Q	154_I	1.179	1.00
117_A	145_I	1.138	1.00
83_V	152_W	1.133	1.00
43_M	114_P	1.126	1.00
65_T	68_E	1.121	1.00
84_A	98_T	1.102	1.00
51_F	126_S	1.101	1.00
29_E	32_K	1.083	1.00
121_Q	153_P	1.075	1.00
167_P	171_K	1.041	1.00
100_A	110_L	1.034	1.00
113_P	116_F	1.029	1.00
62_Y	117_A	1.029	1.00
60_L	85_V	1.009	1.00
9_G	12_V	0.991	1.00
147_Y	157_I	0.989	1.00
32_K	136_D	0.982	1.00
49_M	130_Y	0.980	1.00
26_F	49_M	0.968	1.00
27_F	50_S	0.965	1.00
154_I	157_I	0.963	1.00
82_D	118_H	0.963	1.00
23_K	161_D	0.959	1.00
64_I	141_H	0.957	1.00
121_Q	157_I	0.952	1.00
65_T	141_H	0.951	1.00
87_V	145_I	0.949	1.00
60_L	150_I	0.948	1.00
30_L	47_V	0.943	1.00
35_D	39_H	0.942	1.00
101_E	123_L	0.941	1.00
35_D	38_K	0.921	0.99
81_L	97_Y	0.908	0.99
15_I	35_D	0.906	0.99
54_R	124_D	0.906	0.99
5_F	14_L	0.905	0.99
68_E	141_H	0.896	0.99
18_K	35_D	0.894	0.99
53_V	126_S	0.891	0.99
145_I	172_A	0.890	0.99
142_E	166_C	0.887	0.99
9_G	98_T	0.884	0.99
62_Y	87_V	0.883	0.99
100_A	108_H	0.864	0.99
29_E	69_Q	0.853	0.99
9_G	93_T	0.852	0.99
29_E	46_Q	0.851	0.99
122_A	126_S	0.838	0.99
48_N	133_T	0.835	0.99
37_S	41_I	0.834	0.99
26_F	107_H	0.834	0.99
26_F	128_V	0.826	0.99
21_P	53_V	0.822	0.99
45_V	136_D	0.815	0.99
146_N	166_C	0.802	0.99
11_G	93_T	0.797	0.99
7_D	12_V	0.796	0.99
15_I	39_H	0.792	0.98
158_I	161_D	0.790	0.98
5_F	108_H	0.785	0.98
84_A	116_F	0.782	0.98
76_P	128_V	0.780	0.98
49_M	76_P	0.765	0.98
84_A	112_I	0.756	0.98
130_Y	133_T	0.756	0.98
88_R	116_F	0.755	0.98
10_M	92_P	0.755	0.98
12_V	110_L	0.754	0.98
102_L	110_L	0.749	0.98
123_L	153_P	0.745	0.98
147_Y	159_V	0.739	0.98
36_F	109_M	0.733	0.97
14_L	110_L	0.731	0.97
83_V	150_I	0.727	0.97
99_S	153_P	0.725	0.97
167_P	172_A	0.725	0.97
14_L	98_T	0.725	0.97
84_A	110_L	0.722	0.97
41_I	111_W	0.721	0.97
64_I	172_A	0.720	0.97
10_M	93_T	0.714	0.97
143_R	167_P	0.709	0.97
9_G	84_A	0.699	0.97
95_G	169_L	0.698	0.97
75_V	80_I	0.689	0.96
73_V	129_V	0.687	0.96
41_I	114_P	0.685	0.96
21_P	107_H	0.684	0.96
111_W	134_H	0.683	0.96
75_V	127_L	0.683	0.96
30_L	49_M	0.682	0.96
93_T	96_K	0.679	0.96
15_I	72_L	0.676	0.96
6_E	11_G	0.674	0.96
79_K	127_L	0.669	0.96
71_K	82_D	0.667	0.96
29_E	48_N	0.664	0.95
43_M	134_H	0.660	0.95
162_K	166_C	0.657	0.95
107_H	128_V	0.656	0.95
14_L	106_N	0.652	0.95
144_C	167_P	0.651	0.95
52_S	56_V	0.644	0.95
54_R	155_K	0.641	0.95
62_Y	145_I	0.636	0.94
7_D	98_T	0.635	0.94
74_F	130_Y	0.634	0.94
19_V	28_L	0.633	0.94
104_E	128_V	0.632	0.94
33_A	42_P	0.627	0.94
23_K	158_I	0.625	0.94
143_R	172_A	0.618	0.93
122_A	125_D	0.617	0.93
30_L	74_F	0.613	0.93
85_V	145_I	0.613	0.93
89_K	92_P	0.608	0.93
168_P	172_A	0.607	0.93
98_T	110_L	0.607	0.93
27_F	48_N	0.606	0.93
7_D	100_A	0.603	0.93
12_V	116_F	0.601	0.92
101_E	153_P	0.599	0.92
32_K	36_F	0.599	0.92
36_F	41_I	0.599	0.92
28_L	107_H	0.598	0.92
89_K	95_G	0.597	0.92
60_L	145_I	0.597	0.92
19_V	26_F	0.596	0.92
81_L	123_L	0.594	0.92
68_E	114_P	0.594	0.92
137_Y	142_E	0.591	0.92
22_D	25_G	0.591	0.92
53_V	158_I	0.590	0.92
80_I	120_F	0.590	0.92
45_V	135_N	0.580	0.91
143_R	166_C	0.579	0.91
97_Y	150_I	0.577	0.91
27_F	131_F	0.575	0.91
8_L	12_V	0.571	0.90
51_F	77_K	0.568	0.90
74_F	128_V	0.568	0.90
142_E	162_K	0.568	0.90
30_L	132_V	0.565	0.90
69_Q	133_T	0.563	0.90
34_T	37_S	0.562	0.90
30_L	130_Y	0.561	0.90
54_R	156_E	0.561	0.90
139_P	165_Q	0.560	0.90
77_K	124_D	0.559	0.90
64_I	67_K	0.556	0.89
89_K	172_A	0.554	0.89
104_E	107_H	0.549	0.89
79_K	123_L	0.548	0.89
111_W	114_P	0.547	0.88
13_L	111_W	0.546	0.88
156_E	164_K	0.546	0.88
133_T	162_K	0.543	0.88
16_K	106_N	0.541	0.88
135_N	141_H	0.537	0.88
83_V	99_S	0.537	0.88
53_V	56_V	0.533	0.87
13_L	113_P	0.531	0.87
52_S	58_R	0.527	0.87
72_L	109_M	0.526	0.87
79_K	104_E	0.525	0.86
65_T	172_A	0.525	0.86
98_T	101_E	0.525	0.86
104_E	124_D	0.523	0.86
11_G	116_F	0.520	0.86
18_K	21_P	0.519	0.86
85_V	117_A	0.519	0.86
140_Q	143_R	0.518	0.86
73_V	82_D	0.514	0.85
6_E	39_H	0.513	0.85
72_L	111_W	0.512	0.85
81_L	151_E	0.511	0.85
57_V	152_W	0.511	0.85
56_V	158_I	0.511	0.85
15_I	36_F	0.510	0.85
133_T	143_R	0.510	0.85
79_K	105_S	0.509	0.85
48_N	162_K	0.506	0.84
101_E	106_N	0.505	0.84
159_V	164_K	0.504	0.84
65_T	138_S	0.502	0.84
7_D	110_L	0.500	0.84
75_V	129_V	0.500	0.84

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ixkA	2	0.9943	100	0.187	Contact Map
3rykA	2	0.9602	100	0.189	Contact Map
2c0zA	2	1	100	0.189	Contact Map
1upiA	2	0.9886	100	0.19	Contact Map
1wltA	2	0.9886	100	0.192	Contact Map
1oi6A	2	0.9943	100	0.194	Contact Map
1ep0A	2	0.9886	100	0.196	Contact Map
4hn1A	3	0.983	100	0.198	Contact Map
1dzrA	2	1	100	0.201	Contact Map
5buvA	2	0.9602	100	0.23	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.