Q7LXE3 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LXE3 - Partial ORF from ISC1904

UniProt:	Q7LXE3	Sequences: MRFKEEDVERLMGIIRKRKVILYARVSSNKDDLINQVKYSRRTSKITTKSSPFWIKHEEKRFLKLLGMILDNEVSKVVITYPDRLVRFGLEYPKHTTANS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	100 (90)
Sequences:	401 (289)
Seq/√Len:	30.5

SULSO - Q7LXE3 Q97XQ1 Q97XI0 Q97YH2 Q97YU0 Q97U67 Q97UQ9 Q97U52 Q97XB5 Q97X40 Q97YI6 Q97YX0 Q97XZ4 Q97Y49 Q97Z60 Q97X25 Q97WZ6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_V	76_K	3.699	1.00
50_S	61_R	3.492	1.00
24_A	40_S	3.290	1.00
44_S	78_V	2.674	1.00
69_I	97_T	2.646	1.00
39_Y	80_T	2.608	1.00
22_L	40_S	2.460	0.99
48_T	61_R	2.410	0.99
62_F	85_L	2.286	0.99
46_I	68_M	2.245	0.99
69_I	77_V	1.987	0.97
37_V	47_T	1.858	0.96
19_K	68_M	1.820	0.95
57_H	91_E	1.778	0.94
22_L	47_T	1.693	0.93
86_V	90_L	1.634	0.91
37_V	49_K	1.631	0.91
57_H	86_V	1.630	0.91
43_T	76_K	1.473	0.86
68_M	73_E	1.467	0.86
69_I	74_V	1.424	0.85
55_I	88_F	1.360	0.82
44_S	80_T	1.309	0.79
20_V	78_V	1.292	0.78
59_E	86_V	1.291	0.78
22_L	44_S	1.249	0.76
66_L	92_Y	1.216	0.74
62_F	92_Y	1.194	0.72
66_L	70_L	1.191	0.72
32_D	80_T	1.175	0.71
21_I	74_V	1.160	0.70
20_V	75_S	1.111	0.67
82_P	91_E	1.078	0.64
63_L	95_H	1.065	0.63
21_I	65_L	1.062	0.63
65_L	74_V	1.054	0.63
78_V	91_E	1.048	0.62
55_I	90_L	1.045	0.62
67_G	95_H	1.037	0.61
34_I	38_K	1.025	0.60
62_F	86_V	1.024	0.60
50_S	80_T	1.023	0.60
17_K	67_G	1.005	0.59
51_S	59_E	0.986	0.57
61_R	79_I	0.984	0.57
70_L	96_T	0.978	0.57
86_V	93_P	0.975	0.57
70_L	92_Y	0.968	0.56
20_V	46_I	0.951	0.55
18_R	71_D	0.940	0.54
82_P	94_K	0.933	0.53
14_I	49_K	0.930	0.53
39_Y	50_S	0.923	0.52
52_P	56_K	0.919	0.52
17_K	21_I	0.913	0.52
22_L	92_Y	0.909	0.51
32_D	35_N	0.885	0.49
55_I	89_G	0.883	0.49
50_S	53_F	0.877	0.49
28_S	52_P	0.876	0.49
90_L	93_P	0.870	0.48
69_I	79_I	0.851	0.47
86_V	92_Y	0.807	0.43
31_D	54_W	0.803	0.43
8_V	12_M	0.800	0.43
92_Y	96_T	0.753	0.39
28_S	88_F	0.748	0.39
85_L	92_Y	0.747	0.39
34_I	49_K	0.745	0.38
38_K	41_R	0.744	0.38
12_M	28_S	0.744	0.38
12_M	15_I	0.740	0.38
69_I	81_Y	0.731	0.37
10_R	21_I	0.713	0.36
62_F	75_S	0.710	0.36
48_T	65_L	0.710	0.36
53_F	63_L	0.709	0.36
56_K	65_L	0.704	0.35
42_R	71_D	0.702	0.35
81_Y	93_P	0.700	0.35
26_V	29_N	0.695	0.35
28_S	60_K	0.692	0.34
52_P	89_G	0.692	0.34
90_L	94_K	0.690	0.34
59_E	80_T	0.689	0.34
63_L	93_P	0.684	0.34
28_S	79_I	0.675	0.33
27_S	88_F	0.675	0.33
34_I	47_T	0.669	0.33
78_V	95_H	0.668	0.33
36_Q	84_R	0.666	0.33
54_W	85_L	0.666	0.33
38_K	42_R	0.658	0.32
51_S	90_L	0.655	0.32
24_A	66_L	0.646	0.31
41_R	47_T	0.645	0.31
10_R	13_G	0.645	0.31
11_L	58_E	0.638	0.31
24_A	80_T	0.632	0.30
28_S	48_T	0.626	0.30
29_N	60_K	0.624	0.30
19_K	75_S	0.623	0.30
41_R	45_K	0.615	0.29
60_K	75_S	0.613	0.29
31_D	64_K	0.612	0.29
19_K	46_I	0.612	0.29
8_V	11_L	0.606	0.29
55_I	60_K	0.600	0.28
10_R	81_Y	0.599	0.28
16_R	21_I	0.588	0.27
35_N	62_F	0.586	0.27
44_S	97_T	0.586	0.27
22_L	59_E	0.582	0.27
62_F	69_I	0.575	0.27
65_L	97_T	0.575	0.27
10_R	75_S	0.567	0.26
75_S	93_P	0.565	0.26
34_I	37_V	0.565	0.26
40_S	54_W	0.558	0.26
77_V	97_T	0.544	0.25
42_R	64_K	0.541	0.24
70_L	94_K	0.539	0.24
42_R	90_L	0.536	0.24
35_N	38_K	0.536	0.24
35_N	92_Y	0.535	0.24
18_R	96_T	0.533	0.24
44_S	59_E	0.527	0.24
58_E	95_H	0.525	0.24
28_S	35_N	0.519	0.23
48_T	68_M	0.517	0.23
77_V	95_H	0.506	0.22
19_K	34_I	0.505	0.22
24_A	47_T	0.504	0.22
93_P	97_T	0.501	0.22
15_I	74_V	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3lhkA	2	0.84	99.7	0.561	Contact Map
3ilxA	2	0.82	99.7	0.574	Contact Map
3bvpA	4	0.83	99.6	0.606	Contact Map
3g13A	2	0.87	99.6	0.612	Contact Map
3guvA	2	0.84	99.6	0.617	Contact Map
2mhcA	1	0.88	99.6	0.617	Contact Map
4bqqA	2	0.81	99.5	0.641	Contact Map
2gm5A	4	0.77	99.5	0.645	Contact Map
3pkzA	4	0.8	99.5	0.648	Contact Map
3uj3X	2	0.79	99.4	0.657	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0167 seconds.