Q7LX97 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LX97 - Uncharacterized protein

UniProt:	Q7LX97	Sequences: MENKRICLDTDVLIDAFRNDIKKFIGYYTTCINLYEFLRGLAFIGKNIDEFKSWIELNLNVVCIDNNSLKTASRIYAELRKMGEIIEDPDLLIASICIANDFSLMTHNKKHFKRLEKYGLKLI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	123 (113)
Sequences:	1874 (1458)
Seq/√Len:	137.2

SULSO - Q7LX97

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
43_F	80_R	4.583	1.00
35_Y	72_A	3.699	1.00
30_T	33_N	2.511	1.00
6_I	105_M	2.197	1.00
71_T	98_I	2.171	1.00
34_L	66_N	2.127	1.00
7_C	30_T	2.038	1.00
68_S	96_I	1.999	1.00
38_L	73_S	1.887	1.00
89_P	92_L	1.877	1.00
39_R	76_Y	1.859	1.00
37_F	41_L	1.858	1.00
96_I	100_N	1.823	1.00
44_I	48_I	1.810	1.00
72_A	89_P	1.603	1.00
64_I	92_L	1.565	1.00
68_S	99_A	1.558	1.00
42_A	74_R	1.539	1.00
30_T	96_I	1.538	1.00
15_D	107_H	1.511	1.00
101_D	119_G	1.486	1.00
78_E	116_E	1.486	1.00
72_A	95_S	1.485	1.00
108_N	111_H	1.475	1.00
109_K	113_K	1.461	1.00
47_N	51_F	1.461	1.00
44_I	47_N	1.456	1.00
29_T	33_N	1.434	1.00
7_C	97_C	1.420	1.00
65_D	68_S	1.390	1.00
32_I	92_L	1.381	1.00
94_A	115_L	1.374	1.00
34_L	56_E	1.349	1.00
7_C	102_F	1.339	1.00
78_E	82_M	1.323	1.00
31_C	64_I	1.322	1.00
41_L	48_I	1.295	1.00
87_E	111_H	1.282	1.00
14_I	18_R	1.282	1.00
64_I	68_S	1.256	1.00
88_D	111_H	1.235	1.00
38_L	70_K	1.206	1.00
6_I	103_S	1.180	0.99
14_I	47_N	1.179	0.99
75_I	98_I	1.170	0.99
12_V	15_D	1.162	0.99
35_Y	89_P	1.154	0.99
79_L	114_R	1.131	0.99
86_I	111_H	1.130	0.99
86_I	115_L	1.125	0.99
7_C	28_Y	1.120	0.99
13_L	29_T	1.118	0.99
45_G	48_I	1.098	0.99
111_H	114_R	1.095	0.99
13_L	55_I	1.094	0.99
97_C	104_L	1.081	0.99
73_S	77_A	1.027	0.99
71_T	74_R	1.017	0.98
79_L	91_L	1.013	0.98
65_D	99_A	1.012	0.98
28_Y	62_V	0.991	0.98
47_N	50_E	0.989	0.98
46_K	50_E	0.983	0.98
35_Y	64_I	0.981	0.98
79_L	86_I	0.980	0.98
72_A	92_L	0.975	0.98
84_E	114_R	0.968	0.98
11_D	111_H	0.963	0.98
62_V	100_N	0.963	0.98
22_K	27_Y	0.959	0.98
31_C	69_L	0.947	0.98
42_A	73_S	0.943	0.98
35_Y	95_S	0.941	0.97
45_G	49_D	0.928	0.97
42_A	77_A	0.923	0.97
11_D	112_F	0.916	0.97
74_R	78_E	0.912	0.97
39_R	80_R	0.897	0.97
7_C	96_I	0.893	0.97
65_D	100_N	0.886	0.96
77_A	81_K	0.877	0.96
68_S	100_N	0.875	0.96
85_I	91_L	0.863	0.96
22_K	26_G	0.853	0.96
29_T	59_L	0.852	0.96
12_V	107_H	0.838	0.95
38_L	48_I	0.832	0.95
6_I	102_F	0.818	0.94
74_R	98_I	0.817	0.94
75_I	86_I	0.810	0.94
41_L	51_F	0.797	0.94
62_V	102_F	0.794	0.93
86_I	114_R	0.785	0.93
15_D	18_R	0.775	0.93
29_T	34_L	0.771	0.92
76_Y	91_L	0.765	0.92
16_A	19_N	0.760	0.92
41_L	47_N	0.758	0.92
71_T	99_A	0.757	0.92
98_I	115_L	0.749	0.91
79_L	85_I	0.746	0.91
35_Y	73_S	0.743	0.91
28_Y	60_N	0.738	0.91
72_A	91_L	0.729	0.90
64_I	69_L	0.726	0.90
37_F	56_E	0.725	0.90
12_V	105_M	0.714	0.89
23_K	26_G	0.712	0.89
38_L	52_K	0.708	0.89
67_N	70_K	0.707	0.89
67_N	99_A	0.703	0.89
48_I	51_F	0.699	0.88
79_L	83_G	0.699	0.88
115_L	118_Y	0.698	0.88
34_L	38_L	0.695	0.88
82_M	116_E	0.693	0.88
38_L	42_A	0.686	0.87
14_I	41_L	0.685	0.87
31_C	65_D	0.684	0.87
98_I	118_Y	0.679	0.87
89_P	111_H	0.677	0.87
92_L	96_I	0.676	0.87
48_I	52_K	0.669	0.86
75_I	78_E	0.659	0.85
69_L	73_S	0.658	0.85
32_I	89_P	0.653	0.85
14_I	37_F	0.650	0.84
35_Y	92_L	0.647	0.84
76_Y	80_R	0.644	0.84
14_I	17_F	0.643	0.84
76_Y	88_D	0.642	0.84
87_E	95_S	0.636	0.83
79_L	111_H	0.636	0.83
35_Y	91_L	0.634	0.83
110_K	113_K	0.631	0.83
49_D	53_S	0.630	0.82
106_T	109_K	0.610	0.80
116_E	119_G	0.604	0.80
47_N	55_I	0.593	0.79
11_D	107_H	0.579	0.77
49_D	109_K	0.579	0.77
8_L	96_I	0.575	0.76
21_I	113_K	0.570	0.76
87_E	91_L	0.567	0.75
30_T	97_C	0.564	0.75
43_F	81_K	0.561	0.75
39_R	43_F	0.560	0.74
49_D	52_K	0.560	0.74
47_N	52_K	0.559	0.74
31_C	63_C	0.557	0.74
38_L	51_F	0.555	0.74
30_T	61_V	0.547	0.73
20_D	107_H	0.546	0.73
13_L	17_F	0.546	0.73
37_F	51_F	0.544	0.72
10_T	30_T	0.543	0.72
29_T	55_I	0.534	0.71
15_D	19_N	0.529	0.70
79_L	87_E	0.526	0.70
14_I	44_I	0.520	0.69
33_N	89_P	0.519	0.69
57_L	74_R	0.517	0.69
91_L	111_H	0.512	0.68
63_C	106_T	0.512	0.68
75_I	91_L	0.508	0.67
87_E	108_N	0.507	0.67
53_S	57_L	0.502	0.66
104_L	118_Y	0.502	0.66
68_S	95_S	0.500	0.66
75_I	94_A	0.500	0.66

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1v96A	2	0.9837	99.9	0.441	Contact Map
3h87A	3	0.9675	99.9	0.456	Contact Map
3dboB	1	0.935	99.9	0.467	Contact Map
3zvkA	3	0.9675	99.8	0.504	Contact Map
3tndA	3	0.9756	99.8	0.511	Contact Map
2h1cA	2	0.9593	99.8	0.529	Contact Map
4chgA	2	0.9431	99.7	0.554	Contact Map
1w8iA	2	0.935	99.7	0.584	Contact Map
3i8oA	2	0.9512	99.5	0.634	Contact Map
2fe1A	2	0.8862	99.5	0.637	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.