Q7LX90 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LX90 - Uncharacterized protein

UniProt:	Q7LX90	Sequences: MILNDMNFTTYRKLLTTAKDYLKASELSFEHNLYEASALNSEISAQLSLIFKLGIEPPRTHGIRELLSLIYAKLGDKRISDFTKENREKLIILENVRGKSQYGLPPVSRDEAEIALSTAQEILKLVESLWNL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	132 (119)
Sequences:	97 (93)
Seq/√Len:	8.5

SULSO - Q7LX90 Q97YR7 Q97Y29

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
109_R	113_E	4.707	0.99
26_E	120_Q	4.418	0.99
97_R	101_Q	3.582	0.96
43_I	97_R	3.275	0.93
42_E	46_Q	3.248	0.93
43_I	101_Q	3.169	0.92
41_S	119_A	2.717	0.84
39_L	101_Q	2.706	0.83
28_S	40_N	2.618	0.81
39_L	97_R	2.610	0.81
20_D	33_L	2.459	0.77
39_L	43_I	2.276	0.71
21_Y	36_A	2.119	0.65
27_L	31_H	2.117	0.65
17_T	35_E	1.970	0.59
50_I	79_I	1.801	0.52
21_Y	43_I	1.721	0.49
37_S	112_A	1.644	0.45
21_Y	101_Q	1.620	0.44
57_P	103_G	1.587	0.43
82_F	86_N	1.539	0.41
33_L	100_S	1.533	0.41
21_Y	97_R	1.525	0.40
62_G	94_E	1.495	0.39
38_A	115_A	1.419	0.36
18_A	88_E	1.417	0.36
45_A	119_A	1.405	0.36
67_L	90_L	1.391	0.35
35_E	51_F	1.327	0.33
22_L	119_A	1.324	0.33
62_G	122_I	1.306	0.32
21_Y	39_L	1.305	0.32
40_N	107_V	1.266	0.30
82_F	112_A	1.222	0.29
29_F	37_S	1.199	0.28
76_D	127_E	1.189	0.28
37_S	116_L	1.184	0.28
67_L	83_T	1.158	0.27
15_L	126_V	1.140	0.26
96_V	122_I	1.134	0.26
60_T	126_V	1.089	0.25
112_A	116_L	1.072	0.24
23_K	125_L	1.058	0.24
62_G	65_E	1.058	0.24
38_A	85_E	1.050	0.23
110_D	124_K	1.034	0.23
35_E	115_A	1.031	0.23
16_T	35_E	1.027	0.23
49_L	52_K	1.003	0.22
97_R	107_V	1.002	0.22
64_R	94_E	0.993	0.22
72_A	118_T	0.986	0.21
35_E	96_V	0.980	0.21
67_L	110_D	0.975	0.21
22_L	26_E	0.972	0.21
59_R	93_L	0.972	0.21
49_L	74_L	0.963	0.21
37_S	119_A	0.961	0.21
9_T	59_R	0.938	0.20
10_T	60_T	0.938	0.20
17_T	111_E	0.936	0.20
23_K	30_E	0.935	0.20
24_A	37_S	0.924	0.20
101_Q	107_V	0.923	0.20
62_G	98_G	0.923	0.20
93_L	96_V	0.919	0.20
86_N	95_N	0.916	0.19
38_A	92_I	0.903	0.19
28_S	126_V	0.890	0.19
81_D	85_E	0.881	0.19
57_P	60_T	0.870	0.18
48_S	123_L	0.855	0.18
32_N	109_R	0.851	0.18
40_N	110_D	0.847	0.18
9_T	118_T	0.842	0.18
85_E	121_E	0.836	0.17
30_E	63_I	0.821	0.17
98_G	104_L	0.814	0.17
33_L	58_P	0.804	0.17
77_K	120_Q	0.803	0.17
63_I	73_K	0.802	0.17
9_T	37_S	0.800	0.17
55_I	97_R	0.794	0.16
99_K	107_V	0.792	0.16
109_R	119_A	0.789	0.16
54_G	118_T	0.775	0.16
19_K	123_L	0.773	0.16
23_K	33_L	0.771	0.16
44_S	87_R	0.764	0.16
16_T	56_E	0.761	0.16
70_I	121_E	0.757	0.16
82_F	92_I	0.752	0.15
24_A	29_F	0.741	0.15
36_A	39_L	0.735	0.15
24_A	79_I	0.734	0.15
24_A	28_S	0.733	0.15
27_L	50_I	0.729	0.15
60_T	104_L	0.729	0.15
42_E	59_R	0.728	0.15
55_I	101_Q	0.719	0.15
109_R	112_A	0.711	0.15
30_E	72_A	0.706	0.15
79_I	121_E	0.704	0.14
51_F	86_N	0.700	0.14
94_E	125_L	0.696	0.14
12_R	104_L	0.686	0.14
28_S	111_E	0.684	0.14
68_S	71_Y	0.678	0.14
67_L	86_N	0.677	0.14
20_D	35_E	0.674	0.14
43_I	66_L	0.670	0.14
44_S	93_L	0.665	0.14
62_G	71_Y	0.664	0.14
16_T	30_E	0.664	0.14
29_F	77_K	0.664	0.14
48_S	51_F	0.659	0.14
62_G	126_V	0.655	0.13
27_L	70_I	0.646	0.13
15_L	19_K	0.646	0.13
60_T	94_E	0.641	0.13
53_L	74_L	0.638	0.13
88_E	125_L	0.635	0.13
77_K	81_D	0.631	0.13
107_V	115_A	0.628	0.13
50_I	73_K	0.626	0.13
45_A	78_R	0.625	0.13
29_F	33_L	0.623	0.13
31_H	107_V	0.616	0.13
26_E	69_L	0.613	0.13
14_L	81_D	0.612	0.13
46_Q	64_R	0.611	0.13
16_T	106_P	0.609	0.13
11_Y	122_I	0.607	0.13
113_E	116_L	0.605	0.13
85_E	122_I	0.604	0.12
22_L	29_F	0.603	0.12
57_P	126_V	0.597	0.12
27_L	40_N	0.593	0.12
40_N	111_E	0.592	0.12
27_L	67_L	0.588	0.12
74_L	127_E	0.585	0.12
32_N	58_P	0.585	0.12
106_P	120_Q	0.582	0.12
35_E	62_G	0.581	0.12
11_Y	87_R	0.579	0.12
9_T	77_K	0.572	0.12
29_F	78_R	0.571	0.12
86_N	89_K	0.570	0.12
91_I	95_N	0.570	0.12
95_N	116_L	0.568	0.12
39_L	110_D	0.563	0.12
95_N	98_G	0.560	0.12
72_A	78_R	0.555	0.12
32_N	113_E	0.555	0.12
95_N	105_P	0.553	0.12
43_I	107_V	0.551	0.12
50_I	113_E	0.551	0.12
18_A	95_N	0.548	0.11
20_D	78_R	0.546	0.11
36_A	51_F	0.543	0.11
70_I	123_L	0.541	0.11
75_G	82_F	0.539	0.11
63_I	123_L	0.538	0.11
42_E	66_L	0.537	0.11
36_A	101_Q	0.534	0.11
76_D	106_P	0.527	0.11
67_L	118_T	0.527	0.11
114_I	117_S	0.525	0.11
36_A	60_T	0.524	0.11
18_A	47_L	0.517	0.11
51_F	93_L	0.513	0.11
18_A	55_I	0.511	0.11
12_R	24_A	0.507	0.11
36_A	43_I	0.505	0.11
19_K	108_S	0.503	0.11
52_K	74_L	0.502	0.11
117_S	120_Q	0.501	0.11
15_L	110_D	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4nqfA	2	0.9924	99.9	0.558	Contact Map
1ufbA	3	0.8788	99.8	0.579	Contact Map
3o10A	2	0.9621	99.8	0.583	Contact Map
1o3uA	2	0.8182	99.8	0.593	Contact Map
1wolA	1	0.8409	99.8	0.595	Contact Map
2hsbA	2	0.9015	99.7	0.618	Contact Map
2jpuA	1	0.7803	61.4	0.919	Contact Map
3jz0A	2	0.8636	26.2	0.935	Contact Map
3n71A	1	0.9697	17.6	0.94	Contact Map
2v6yA	1	0.5606	14.5	0.942	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.