Q7LX87 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LX87 - Uncharacterized protein

UniProt:	Q7LX87	Sequences: MSISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKNKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLNEKEVKKLKEDVRKLVIFAVNS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	121 (111)
Sequences:	107 (95)
Seq/√Len:	9.0

SULSO - Q7LX87 Q97WV1 Q97WV2 Q97Y35

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_E	112_R	3.840	0.98
66_F	87_W	2.669	0.84
7_A	10_Y	2.628	0.83
93_G	96_E	2.530	0.81
92_E	98_S	2.394	0.77
49_E	54_V	2.350	0.75
14_A	21_G	2.301	0.74
66_F	99_L	2.249	0.72
89_L	111_V	2.127	0.68
11_Y	115_V	2.120	0.67
11_Y	33_A	2.088	0.66
20_K	52_N	2.077	0.66
90_H	96_E	1.965	0.61
50_I	54_V	1.923	0.59
47_L	88_T	1.841	0.56
6_S	59_R	1.779	0.53
7_A	42_V	1.749	0.52
90_H	95_H	1.735	0.51
84_K	107_L	1.729	0.51
54_V	88_T	1.662	0.48
65_L	83_W	1.648	0.48
90_H	93_G	1.611	0.46
53_N	57_K	1.588	0.45
45_N	72_L	1.563	0.44
90_H	94_F	1.535	0.43
109_E	113_K	1.533	0.43
69_S	74_S	1.511	0.42
62_S	66_F	1.487	0.41
14_A	18_L	1.393	0.37
87_W	90_H	1.381	0.36
34_A	85_S	1.359	0.35
50_I	98_S	1.349	0.35
66_F	92_E	1.343	0.35
39_K	60_W	1.277	0.32
19_S	105_K	1.274	0.32
38_I	67_K	1.268	0.32
41_L	83_W	1.246	0.31
12_E	52_N	1.238	0.31
104_V	111_V	1.225	0.30
42_V	48_K	1.224	0.30
6_S	40_L	1.222	0.30
112_R	116_I	1.213	0.30
74_S	102_K	1.181	0.29
78_E	117_F	1.179	0.29
87_W	114_L	1.171	0.28
100_N	106_K	1.123	0.27
105_K	116_I	1.115	0.26
37_A	114_L	1.102	0.26
72_L	79_I	1.100	0.26
112_R	115_V	1.096	0.26
24_V	62_S	1.093	0.26
85_S	107_L	1.045	0.24
66_F	98_S	1.026	0.23
91_V	95_H	1.025	0.23
59_R	90_H	1.024	0.23
47_L	58_G	1.013	0.23
44_E	72_L	0.999	0.23
67_K	100_N	0.985	0.22
57_K	72_L	0.985	0.22
88_T	99_L	0.979	0.22
101_E	115_V	0.978	0.22
53_N	56_N	0.967	0.22
91_V	96_E	0.956	0.21
100_N	105_K	0.929	0.21
74_S	106_K	0.918	0.20
23_L	73_R	0.915	0.20
73_R	100_N	0.908	0.20
63_E	72_L	0.901	0.20
80_P	105_K	0.897	0.20
23_L	30_Y	0.897	0.20
45_N	115_V	0.878	0.19
110_D	114_L	0.864	0.19
78_E	111_V	0.857	0.19
47_L	75_N	0.857	0.19
59_R	65_L	0.844	0.18
11_Y	112_R	0.843	0.18
29_K	36_E	0.840	0.18
7_A	11_Y	0.836	0.18
91_V	94_F	0.834	0.18
27_C	39_K	0.832	0.18
24_V	42_V	0.815	0.18
33_A	50_I	0.814	0.18
38_I	77_T	0.813	0.17
9_V	34_A	0.807	0.17
58_G	73_R	0.804	0.17
8_E	53_N	0.777	0.17
69_S	87_W	0.776	0.17
54_V	64_N	0.775	0.17
9_V	38_I	0.765	0.16
49_E	72_L	0.764	0.16
86_A	102_K	0.763	0.16
37_A	67_K	0.761	0.16
54_V	89_L	0.761	0.16
41_L	65_L	0.742	0.16
18_L	105_K	0.742	0.16
87_W	95_H	0.741	0.16
10_Y	34_A	0.739	0.16
12_E	38_I	0.732	0.16
24_V	65_L	0.720	0.15
19_S	111_V	0.720	0.15
91_V	98_S	0.713	0.15
17_F	43_I	0.712	0.15
21_G	83_W	0.710	0.15
22_D	47_L	0.703	0.15
33_A	43_I	0.700	0.15
47_L	99_L	0.698	0.15
45_N	76_N	0.698	0.15
15_E	116_I	0.697	0.15
46_N	65_L	0.689	0.15
15_E	49_E	0.688	0.15
43_I	52_N	0.679	0.14
23_L	104_V	0.669	0.14
102_K	109_E	0.665	0.14
9_V	12_E	0.664	0.14
56_N	102_K	0.654	0.14
18_L	23_L	0.651	0.14
38_I	103_E	0.647	0.14
48_K	52_N	0.647	0.14
66_F	88_T	0.642	0.14
21_G	79_I	0.642	0.14
34_A	109_E	0.637	0.14
65_L	73_R	0.628	0.13
85_S	111_V	0.626	0.13
17_F	48_K	0.622	0.13
87_W	93_G	0.619	0.13
50_I	64_N	0.618	0.13
7_A	12_E	0.613	0.13
37_A	66_F	0.612	0.13
26_A	111_V	0.599	0.13
53_N	64_N	0.598	0.13
59_R	95_H	0.597	0.13
38_I	64_N	0.596	0.13
34_A	83_W	0.595	0.13
22_D	39_K	0.595	0.13
57_K	61_K	0.591	0.13
40_L	97_L	0.590	0.13
12_E	75_N	0.589	0.13
69_S	101_E	0.582	0.12
38_I	41_L	0.579	0.12
38_I	114_L	0.575	0.12
48_K	111_V	0.575	0.12
55_K	79_I	0.573	0.12
16_E	56_N	0.567	0.12
11_Y	114_L	0.562	0.12
30_Y	61_K	0.556	0.12
30_Y	40_L	0.548	0.12
16_E	52_N	0.545	0.12
59_R	91_V	0.542	0.12
101_E	113_K	0.540	0.12
10_Y	35_E	0.539	0.12
87_W	96_E	0.538	0.12
56_N	74_S	0.535	0.12
9_V	43_I	0.534	0.12
26_A	36_E	0.528	0.11
13_E	77_T	0.524	0.11
10_Y	13_E	0.519	0.11
47_L	116_I	0.516	0.11
98_S	117_F	0.511	0.11
17_F	76_N	0.511	0.11
97_L	103_E	0.510	0.11
57_K	67_K	0.510	0.11
38_I	55_K	0.508	0.11
22_D	28_E	0.506	0.11
49_E	89_L	0.502	0.11
48_K	86_A	0.501	0.11
114_L	117_F	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2jpuA	1	1	100	0.22	Contact Map
2hsbA	2	0.9174	93.1	0.89	Contact Map
1wolA	1	0.9091	83.7	0.908	Contact Map
1o3uA	2	0.8843	76.5	0.915	Contact Map
1ufbA	3	0.9091	69.7	0.919	Contact Map
4nqfA	2	0.9091	61	0.923	Contact Map
3o10A	2	0.9174	59.5	0.924	Contact Map
4fzpA	2	0.405	30.9	0.936	Contact Map
4iwbA	1	0.7438	17.9	0.943	Contact Map
1knyA	2	0.8347	17.5	0.943	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.