Q7LX67 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LX67 - Transcriptional regulator homolog (Lrp/AsnC family)

UniProt:	Q7LX67	Sequences: MMGVNIIRLDDTDEKILNILRYNAKKSLKELSDELGIPISTVRYRIKRLEDAQIIRGYVALIDRVNLGLNVSLVMEIETVPYSIKKVAQDLGEIPEVVRIYGLDNGPRLHVHMIFKDDASAHQFIANKLYNIKGIKTVSISRIIERYKIDPSVLL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	155 (138)
Sequences:	13680 (8750)
Seq/√Len:	744.8

ECOLI - LRP YBAO ASNC
BACSU - YWRC AZLB YUGG LRPB LRPC YEZC LRPA
HALSA - Q9HQ13 Q9HNI1 Q9HQ33 Q9HQB6 Q9HP41 Q9HQG1 Q9HP70 Q9HNW8
SULSO - Q7LX67 Q97W90 Q7LXS6 Q97XP7 LYSM Q97X78 Q980P3 Q97VN7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
19_I	34_E	2.945	1.00
50_E	58_Y	2.824	1.00
78_E	137_T	2.591	1.00
106_G	139_S	2.524	1.00
99_R	112_H	2.425	1.00
116_K	120_S	2.279	1.00
28_L	46_I	2.250	1.00
65_V	119_A	2.080	1.00
19_I	26_K	2.028	1.00
13_D	45_R	2.021	1.00
48_R	52_A	2.020	1.00
56_R	63_D	1.967	1.00
80_V	136_K	1.895	1.00
94_I	128_K	1.863	1.00
72_S	112_H	1.824	1.00
74_V	101_Y	1.806	1.00
56_R	61_L	1.795	1.00
98_V	114_I	1.782	1.00
12_T	37_I	1.721	1.00
94_I	124_F	1.674	1.00
19_I	22_Y	1.672	1.00
47_K	51_D	1.661	1.00
37_I	41_T	1.651	1.00
76_E	141_S	1.621	1.00
29_K	33_D	1.589	1.00
26_K	34_E	1.536	1.00
117_D	120_S	1.531	1.00
90_D	93_E	1.525	1.00
90_D	132_I	1.482	1.00
29_K	39_I	1.474	1.00
30_E	33_D	1.464	1.00
120_S	123_Q	1.454	1.00
37_I	42_V	1.448	1.00
87_V	91_L	1.426	1.00
38_P	41_T	1.425	1.00
96_E	120_S	1.423	1.00
16_I	31_L	1.408	1.00
77_I	111_V	1.402	1.00
88_A	92_G	1.376	1.00
78_E	106_G	1.370	1.00
83_S	86_K	1.359	1.00
35_L	42_V	1.345	1.00
28_L	43_R	1.335	1.00
25_K	58_Y	1.321	1.00
85_K	89_Q	1.303	1.00
11_D	15_K	1.300	1.00
76_E	107_P	1.292	1.00
75_M	113_M	1.265	1.00
71_V	118_D	1.262	1.00
78_E	136_K	1.257	1.00
69_L	116_K	1.256	1.00
26_K	31_L	1.245	1.00
20_L	46_I	1.235	1.00
79_T	87_V	1.231	1.00
30_E	34_E	1.225	1.00
12_T	15_K	1.220	1.00
47_K	50_E	1.200	1.00
88_A	145_E	1.196	1.00
22_Y	34_E	1.195	1.00
122_H	145_E	1.190	1.00
27_S	30_E	1.180	1.00
96_E	128_K	1.147	1.00
19_I	31_L	1.105	1.00
23_N	34_E	1.105	1.00
10_D	45_R	1.102	1.00
57_G	61_L	1.096	1.00
76_E	139_S	1.092	1.00
12_T	35_L	1.082	1.00
72_S	114_I	1.072	1.00
15_K	18_N	1.050	1.00
97_V	113_M	1.033	1.00
28_L	32_S	1.027	1.00
115_F	120_S	1.013	1.00
15_K	19_I	1.006	1.00
63_D	66_N	1.004	1.00
100_I	111_V	1.004	1.00
26_K	30_E	0.989	1.00
86_K	90_D	0.989	1.00
89_Q	92_G	0.989	1.00
18_N	22_Y	0.982	1.00
88_A	109_L	0.971	1.00
32_S	42_V	0.969	1.00
74_V	110_H	0.964	1.00
43_R	47_K	0.959	1.00
101_Y	112_H	0.951	1.00
25_K	50_E	0.949	1.00
24_A	58_Y	0.941	1.00
15_K	35_L	0.932	1.00
122_H	126_A	0.931	1.00
113_M	124_F	0.931	1.00
39_I	43_R	0.923	1.00
115_F	121_A	0.922	1.00
103_L	110_H	0.913	1.00
74_V	112_H	0.906	1.00
102_G	126_A	0.905	1.00
89_Q	93_E	0.895	1.00
9_L	14_E	0.893	1.00
115_F	124_F	0.890	1.00
106_G	137_T	0.881	1.00
32_S	37_I	0.878	1.00
80_V	83_S	0.852	1.00
28_L	39_I	0.850	1.00
24_A	30_E	0.849	1.00
97_V	100_I	0.849	1.00
70_N	117_D	0.848	1.00
64_R	114_I	0.840	1.00
97_V	111_V	0.836	1.00
29_K	43_R	0.835	1.00
14_E	18_N	0.821	1.00
49_L	54_I	0.815	1.00
74_V	143_I	0.809	1.00
101_Y	143_I	0.800	1.00
91_L	100_I	0.799	1.00
90_D	94_I	0.798	1.00
13_D	48_R	0.794	1.00
76_E	110_H	0.783	1.00
85_K	88_A	0.780	1.00
16_I	45_R	0.780	1.00
10_D	13_D	0.774	1.00
77_I	87_V	0.773	1.00
31_L	42_V	0.769	1.00
125_I	140_I	0.766	1.00
40_S	44_Y	0.755	1.00
16_I	42_V	0.754	1.00
101_Y	146_R	0.746	1.00
9_L	54_I	0.743	1.00
107_P	139_S	0.740	1.00
24_A	60_A	0.731	1.00
84_I	109_L	0.728	1.00
76_E	106_G	0.722	1.00
86_K	89_Q	0.704	1.00
31_L	46_I	0.704	1.00
96_E	124_F	0.703	1.00
80_V	134_G	0.695	1.00
104_D	142_R	0.690	1.00
78_E	107_P	0.689	1.00
23_N	26_K	0.687	1.00
19_I	23_N	0.681	1.00
11_D	14_E	0.677	1.00
73_L	121_A	0.673	1.00
130_Y	138_V	0.673	1.00
88_A	147_Y	0.666	1.00
69_L	114_I	0.665	1.00
69_L	96_E	0.658	1.00
54_I	66_N	0.656	1.00
75_M	111_V	0.654	1.00
16_I	26_K	0.650	1.00
118_D	142_R	0.647	1.00
119_A	122_H	0.647	1.00
87_V	109_L	0.643	1.00
72_S	143_I	0.642	1.00
44_Y	48_R	0.642	1.00
17_L	49_L	0.641	1.00
13_D	49_L	0.641	1.00
16_I	19_I	0.634	1.00
86_K	134_G	0.634	1.00
125_I	138_V	0.633	1.00
75_M	138_V	0.628	1.00
85_K	126_A	0.627	1.00
32_S	39_I	0.626	1.00
91_L	111_V	0.623	1.00
44_Y	47_K	0.619	1.00
16_I	46_I	0.617	1.00
123_Q	128_K	0.617	1.00
45_R	49_L	0.616	1.00
63_D	67_L	0.615	1.00
40_S	43_R	0.614	1.00
96_E	116_K	0.612	1.00
119_A	123_Q	0.611	1.00
94_I	132_I	0.610	1.00
53_Q	56_R	0.610	1.00
120_S	124_F	0.609	1.00
24_A	57_G	0.607	1.00
124_F	128_K	0.607	1.00
102_G	109_L	0.600	1.00
73_L	142_R	0.600	1.00
103_L	107_P	0.582	1.00
62_I	67_L	0.579	1.00
28_L	42_V	0.576	1.00
72_S	101_Y	0.575	1.00
55_I	58_Y	0.574	1.00
77_I	135_I	0.573	1.00
16_I	49_L	0.567	1.00
128_K	132_I	0.563	1.00
61_L	64_R	0.562	1.00
118_D	144_I	0.561	1.00
72_S	146_R	0.548	1.00
103_L	143_I	0.548	1.00
21_R	59_V	0.543	1.00
83_S	133_K	0.537	1.00
12_T	41_T	0.531	1.00
130_Y	137_T	0.530	1.00
76_E	103_L	0.525	1.00
73_L	140_I	0.521	1.00
48_R	51_D	0.519	1.00
125_I	144_I	0.519	1.00
103_L	141_S	0.518	1.00
79_T	108_R	0.514	1.00
81_P	136_K	0.513	1.00
29_K	32_S	0.508	1.00
90_D	134_G	0.506	1.00
124_F	129_L	0.505	1.00
78_E	139_S	0.505	1.00
102_G	108_R	0.504	1.00
85_K	131_N	0.504	1.00
98_V	112_H	0.502	1.00
90_D	133_K	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ch7A	1	0.9355	100	0.152	Contact Map
4un1B	1	0.9613	100	0.186	Contact Map
2e1cA	1	0.9484	100	0.197	Contact Map
4pcqA	2	0.9548	100	0.199	Contact Map
4un1A	1	0.9161	100	0.201	Contact Map
2p5vA	5	0.9806	100	0.211	Contact Map
2ia0A	2	0.929	100	0.211	Contact Map
3i4pA	5	0.9419	100	0.238	Contact Map
2cg4A	6	0.9548	100	0.238	Contact Map
2pn6A	5	0.9419	100	0.243	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.