Q7LX63 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LX63 - Uncharacterized protein

UniProt:	Q7LX63	Sequences: MSELIARQKGRLRLMTLWLLWQSPRRGIEIIDDINKMTWGFWKPSPGSIYPLLNKMEEEGVIEKTSDGKYKITAKGSEEIKEFLPIKQINSIEDSVQELEGLAQFFKEVERNKLIEYKHRIISAIKEIEEVVKNA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	135 (121)
Sequences:	1019 (663)
Seq/√Len:	60.2

ECOLI - YQJI
SULSO - Q7LX63 Q981A9 Q981A0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
123_S	127_E	5.915	1.00
74_A	77_S	3.873	1.00
63_E	71_K	3.491	1.00
16_T	30_I	3.398	1.00
117_Y	128_I	3.278	1.00
54_N	58_E	2.939	1.00
120_R	124_A	2.711	1.00
22_Q	37_M	2.560	1.00
94_D	122_I	2.310	1.00
23_S	29_E	2.240	1.00
110_E	113_K	2.218	1.00
33_D	36_K	2.028	1.00
113_K	116_E	1.894	1.00
79_E	83_F	1.773	0.99
103_A	128_I	1.685	0.99
10_G	13_R	1.647	0.99
59_E	72_I	1.626	0.99
7_R	16_T	1.611	0.99
16_T	49_I	1.603	0.99
78_E	82_E	1.558	0.99
7_R	42_W	1.537	0.98
13_R	59_E	1.531	0.98
21_W	84_L	1.490	0.98
53_L	70_Y	1.393	0.97
94_D	98_E	1.386	0.97
16_T	52_L	1.383	0.97
21_W	77_S	1.362	0.97
95_S	122_I	1.362	0.97
123_S	126_K	1.351	0.96
38_T	42_W	1.350	0.96
81_K	84_L	1.344	0.96
78_E	81_K	1.315	0.96
36_K	56_M	1.314	0.96
98_E	122_I	1.277	0.95
61_V	79_E	1.269	0.95
75_K	78_E	1.265	0.95
121_I	124_A	1.261	0.95
25_R	33_D	1.246	0.94
96_V	103_A	1.197	0.93
119_H	126_K	1.197	0.93
13_R	52_L	1.189	0.93
79_E	82_E	1.170	0.92
66_S	69_K	1.169	0.92
120_R	127_E	1.168	0.92
48_S	52_L	1.162	0.92
85_P	89_I	1.145	0.91
122_I	130_E	1.138	0.91
64_K	71_K	1.123	0.91
43_K	49_I	1.116	0.90
124_A	128_I	1.108	0.90
32_D	43_K	1.096	0.89
46_P	70_Y	1.094	0.89
7_R	12_L	1.089	0.89
25_R	30_I	1.078	0.89
20_L	72_I	1.071	0.88
52_L	56_M	1.063	0.88
80_I	83_F	1.058	0.88
92_I	102_L	1.053	0.87
52_L	55_K	1.017	0.86
25_R	29_E	0.997	0.84
9_K	12_L	0.993	0.84
55_K	69_K	0.991	0.84
21_W	34_I	0.987	0.84
65_T	68_G	0.959	0.82
21_W	74_A	0.947	0.81
34_I	37_M	0.931	0.80
102_L	105_F	0.929	0.80
111_R	114_L	0.919	0.79
116_E	119_H	0.911	0.79
97_Q	104_Q	0.896	0.77
28_I	124_A	0.893	0.77
55_K	79_E	0.891	0.77
63_E	74_A	0.882	0.76
126_K	130_E	0.871	0.75
26_R	42_W	0.864	0.75
96_V	100_E	0.862	0.75
10_G	73_T	0.857	0.74
16_T	83_F	0.853	0.74
55_K	58_E	0.848	0.73
10_G	38_T	0.847	0.73
18_W	22_Q	0.846	0.73
12_L	129_E	0.843	0.73
91_S	122_I	0.837	0.72
14_L	80_I	0.835	0.72
8_Q	16_T	0.825	0.71
19_L	24_P	0.814	0.70
28_I	42_W	0.806	0.70
91_S	94_D	0.806	0.70
94_D	97_Q	0.797	0.69
41_F	70_Y	0.794	0.68
95_S	121_I	0.771	0.66
57_E	103_A	0.770	0.66
20_L	25_R	0.764	0.65
34_I	92_I	0.748	0.64
9_K	68_G	0.747	0.64
126_K	129_E	0.746	0.64
77_S	81_K	0.732	0.62
10_G	48_S	0.727	0.62
58_E	61_V	0.720	0.61
7_R	80_I	0.720	0.61
33_D	37_M	0.719	0.61
28_I	32_D	0.716	0.60
10_G	28_I	0.711	0.60
125_I	129_E	0.702	0.59
120_R	123_S	0.699	0.59
94_D	130_E	0.698	0.58
91_S	120_R	0.691	0.58
34_I	118_K	0.690	0.58
59_E	79_E	0.689	0.57
93_E	107_K	0.689	0.57
11_R	33_D	0.686	0.57
74_A	81_K	0.681	0.57
33_D	114_L	0.680	0.56
100_E	118_K	0.676	0.56
106_F	117_Y	0.661	0.54
105_F	126_K	0.660	0.54
9_K	16_T	0.660	0.54
99_L	124_A	0.657	0.54
54_N	70_Y	0.655	0.54
118_K	122_I	0.651	0.53
115_I	123_S	0.649	0.53
115_I	119_H	0.642	0.52
9_K	29_E	0.641	0.52
105_F	129_E	0.638	0.52
92_I	96_V	0.634	0.51
55_K	59_E	0.630	0.51
12_L	15_M	0.628	0.51
95_S	118_K	0.626	0.50
117_Y	125_I	0.625	0.50
115_I	122_I	0.622	0.50
33_D	63_E	0.621	0.50
17_L	80_I	0.617	0.49
32_D	40_G	0.617	0.49
64_K	67_D	0.615	0.49
90_N	120_R	0.611	0.49
34_I	96_V	0.605	0.48
101_G	104_Q	0.604	0.48
122_I	126_K	0.602	0.48
98_E	103_A	0.599	0.47
60_G	75_K	0.595	0.47
71_K	77_S	0.594	0.47
13_R	38_T	0.590	0.46
14_L	34_I	0.583	0.46
92_I	104_Q	0.583	0.46
42_W	80_I	0.581	0.45
11_R	23_S	0.576	0.45
91_S	101_G	0.574	0.45
16_T	20_L	0.573	0.44
22_Q	112_N	0.573	0.44
104_Q	108_E	0.573	0.44
42_W	106_F	0.571	0.44
50_Y	53_L	0.571	0.44
93_E	101_G	0.561	0.43
32_D	117_Y	0.557	0.43
84_L	110_E	0.556	0.43
92_I	100_E	0.555	0.42
19_L	30_I	0.553	0.42
121_I	126_K	0.553	0.42
27_G	50_Y	0.552	0.42
75_K	82_E	0.550	0.42
116_E	127_E	0.545	0.41
14_L	30_I	0.545	0.41
61_V	73_T	0.542	0.41
112_N	116_E	0.540	0.41
75_K	81_K	0.537	0.41
89_I	119_H	0.531	0.40
15_M	83_F	0.530	0.40
18_W	37_M	0.528	0.40
14_L	72_I	0.525	0.39
69_K	103_A	0.525	0.39
36_K	49_I	0.523	0.39
40_G	117_Y	0.521	0.39
29_E	120_R	0.517	0.38
91_S	102_L	0.511	0.38
29_E	116_E	0.511	0.38
35_N	40_G	0.508	0.37
14_L	42_W	0.505	0.37
7_R	15_M	0.504	0.37
7_R	61_V	0.503	0.37
29_E	100_E	0.503	0.37
122_I	129_E	0.500	0.37
15_M	38_T	0.500	0.37

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1bm9A	2	0.763	99.8	0.569	Contact Map
2rkhA	2	0.8963	99.8	0.584	Contact Map
3l9fA	2	0.8963	99.7	0.588	Contact Map
1yg2A	2	0.8963	99.6	0.625	Contact Map
2zfwA	2	0.6815	99.6	0.645	Contact Map
1xmaA	2	0.7185	99.6	0.647	Contact Map
2e1nA	2	0.6815	99.5	0.651	Contact Map
2dqlA	2	0.7037	99.5	0.663	Contact Map
2eshA	2	0.7704	99.4	0.671	Contact Map
3f8bA	2	0.7185	99.4	0.671	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.