Q7LX55 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LX55 - Uncharacterized protein

UniProt:	Q7LX55	Sequences: MRILIFVEYPYFDLETARELLPWLRDRLIQLRKIKNEIELLLVNGDKYALQQYASETKKIIDEIISKGIILRDIDIGLVDFPAIINNKPAFFCWKIDENDIAYWHYMDEGFRGRKRLTGYEDILSLR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	127 (109)
Sequences:	176 (136)
Seq/√Len:	13.1

SULSO - Q7LX55

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
25_R	99_N	2.843	0.95
70_I	91_F	2.777	0.95
35_K	75_D	2.756	0.94
24_L	64_I	2.627	0.93
18_R	100_D	2.608	0.93
73_D	76_I	2.534	0.92
21_L	24_L	2.345	0.88
88_K	106_Y	2.230	0.85
22_P	26_D	2.195	0.84
104_W	118_T	1.957	0.76
90_A	95_K	1.927	0.75
73_D	77_G	1.858	0.72
14_L	101_I	1.813	0.70
69_I	79_V	1.725	0.66
21_L	28_L	1.697	0.65
21_L	101_I	1.687	0.65
95_K	111_F	1.658	0.63
106_Y	109_E	1.647	0.63
12_F	68_G	1.630	0.62
24_L	28_L	1.624	0.62
76_I	96_I	1.610	0.61
72_R	78_L	1.604	0.61
78_L	110_G	1.556	0.58
41_L	111_F	1.521	0.56
109_E	115_K	1.493	0.55
50_L	118_T	1.422	0.51
28_L	73_D	1.415	0.51
21_L	91_F	1.415	0.51
57_T	112_R	1.401	0.50
15_E	90_A	1.401	0.50
104_W	115_K	1.394	0.50
26_D	69_I	1.372	0.49
93_C	114_R	1.344	0.47
27_R	30_Q	1.306	0.45
72_R	97_D	1.294	0.45
48_Y	88_K	1.278	0.44
78_L	113_G	1.256	0.43
15_E	87_N	1.227	0.41
76_I	117_L	1.218	0.41
24_L	34_I	1.200	0.40
73_D	96_I	1.175	0.38
21_L	63_E	1.145	0.37
102_A	116_R	1.145	0.37
72_R	111_F	1.127	0.36
21_L	99_N	1.123	0.36
91_F	104_W	1.108	0.35
20_L	64_I	1.099	0.35
83_A	100_D	1.095	0.35
22_P	82_P	1.095	0.35
54_A	91_F	1.093	0.34
99_N	102_A	1.080	0.34
79_V	89_P	1.079	0.34
41_L	49_A	1.077	0.34
27_R	31_L	1.069	0.33
27_R	71_L	1.052	0.33
50_L	97_D	1.051	0.33
64_I	69_I	1.044	0.32
10_P	16_T	1.028	0.31
25_R	96_I	1.024	0.31
61_I	116_R	1.016	0.31
38_I	54_A	1.015	0.31
20_L	73_D	1.013	0.31
25_R	97_D	1.009	0.31
28_L	31_L	0.997	0.30
49_A	107_M	0.993	0.30
18_R	51_Q	0.966	0.29
22_P	77_G	0.955	0.28
42_L	106_Y	0.943	0.28
44_N	48_Y	0.938	0.28
14_L	70_I	0.938	0.28
80_D	113_G	0.927	0.27
22_P	98_E	0.927	0.27
18_R	31_L	0.923	0.27
72_R	113_G	0.922	0.27
13_D	87_N	0.916	0.27
19_E	26_D	0.888	0.26
54_A	104_W	0.875	0.25
85_I	90_A	0.872	0.25
49_A	115_K	0.871	0.25
39_E	58_K	0.849	0.24
62_D	117_L	0.842	0.24
57_T	71_L	0.840	0.24
71_L	117_L	0.827	0.23
51_Q	57_T	0.816	0.23
111_F	118_T	0.807	0.22
42_L	79_V	0.796	0.22
20_L	23_W	0.792	0.22
110_G	113_G	0.784	0.22
19_E	66_S	0.772	0.21
101_I	104_W	0.763	0.21
40_L	62_D	0.760	0.21
72_R	80_D	0.746	0.20
42_L	109_E	0.743	0.20
71_L	118_T	0.730	0.20
38_I	85_I	0.730	0.20
72_R	91_F	0.723	0.20
11_Y	14_L	0.722	0.19
36_N	48_Y	0.721	0.19
19_E	56_E	0.718	0.19
67_K	88_K	0.714	0.19
84_I	89_P	0.704	0.19
11_Y	84_I	0.703	0.19
27_R	50_L	0.702	0.19
82_P	117_L	0.700	0.19
73_D	111_F	0.696	0.19
94_W	98_E	0.695	0.19
38_I	50_L	0.689	0.18
32_R	101_I	0.684	0.18
86_N	99_N	0.673	0.18
24_L	81_F	0.672	0.18
28_L	77_G	0.665	0.18
57_T	75_D	0.658	0.17
26_D	56_E	0.657	0.17
37_E	58_K	0.657	0.17
52_Q	91_F	0.657	0.17
21_L	71_L	0.656	0.17
102_A	111_F	0.654	0.17
16_T	104_W	0.653	0.17
14_L	34_I	0.642	0.17
11_Y	89_P	0.641	0.17
58_K	65_I	0.640	0.17
98_E	114_R	0.638	0.17
30_Q	60_I	0.637	0.17
23_W	63_E	0.634	0.17
39_E	61_I	0.629	0.17
37_E	46_D	0.625	0.16
20_L	28_L	0.625	0.16
14_L	99_N	0.619	0.16
43_V	112_R	0.610	0.16
12_F	82_P	0.603	0.16
92_F	98_E	0.597	0.16
51_Q	106_Y	0.593	0.16
97_D	102_A	0.591	0.16
64_I	109_E	0.590	0.16
30_Q	38_I	0.585	0.15
30_Q	117_L	0.584	0.15
72_R	90_A	0.578	0.15
49_A	56_E	0.574	0.15
37_E	91_F	0.572	0.15
25_R	31_L	0.569	0.15
33_K	117_L	0.569	0.15
11_Y	79_V	0.567	0.15
36_N	41_L	0.566	0.15
18_R	45_G	0.566	0.15
61_I	107_M	0.559	0.15
13_D	16_T	0.556	0.15
48_Y	79_V	0.552	0.14
16_T	41_L	0.551	0.14
32_R	96_I	0.547	0.14
55_S	87_N	0.545	0.14
66_S	117_L	0.531	0.14
77_G	81_F	0.530	0.14
32_R	91_F	0.529	0.14
55_S	115_K	0.521	0.14
93_C	98_E	0.518	0.14
61_I	66_S	0.515	0.14
40_L	45_G	0.514	0.14
70_I	82_P	0.514	0.14
43_V	106_Y	0.510	0.13
68_G	95_K	0.507	0.13
24_L	98_E	0.505	0.13
75_D	90_A	0.504	0.13
35_K	39_E	0.501	0.13
13_D	73_D	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1r8dA	2	0.4724	12.5	0.944	Contact Map
1ccwB	2	0.9291	11.7	0.945	Contact Map
1rv3A	3	0.5669	11.2	0.946	Contact Map
4jrbA	1	0.5669	10.1	0.947	Contact Map
2vz4A	2	0.4173	10	0.947	Contact Map
2lvsA	1	0.5433	8.9	0.948	Contact Map
3smtA	2	0.7323	8.8	0.948	Contact Map
3h0gD	1	0.3622	8.7	0.948	Contact Map
2akfA	3	0.252	8.4	0.949	Contact Map
3gpvA	2	0.4882	7.3	0.95	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.