Q7LX53 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LX53 - Uncharacterized protein

UniProt:	Q7LX53	Sequences: MTQVIESYSSPFYKNIIDLPPSMVRKLWKSGKIMILDIRTPQEYEEHHIPGAILAPLDYLEHLTELFEDKEVAVVCEHGNRARYATYGMPHLYKKRAYYMIGGMALWMCLPVA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	113 (95)
Sequences:	10182 (7442)
Seq/√Len:	763.5

ECOLI - YIBN GLPE THTM YGAP PSPE YNJE
BACSU - YQHL YRKF YTWF YRKH
HALSA - Q9HMT6 Q9HME4 Q9HMT7 O54647 O54661 Q9HS22
SULSO - Q7LX53 Q97VI9 Q97XC6 Q97ZB1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
41_P	45_E	3.074	1.00
71_E	98_Y	3.049	1.00
34_M	70_K	2.313	1.00
44_Y	48_H	2.287	1.00
20_P	23_M	2.179	1.00
19_L	23_M	2.158	1.00
47_H	108_M	2.135	1.00
106_L	110_L	2.124	1.00
23_M	27_L	2.118	1.00
21_P	106_L	1.958	1.00
41_P	54_L	1.907	1.00
24_V	35_I	1.759	1.00
27_L	30_S	1.735	1.00
62_H	65_E	1.698	1.00
71_E	96_R	1.686	1.00
21_P	110_L	1.681	1.00
74_V	89_M	1.618	1.00
43_E	81_R	1.552	1.00
19_L	98_Y	1.398	1.00
86_T	97_A	1.385	1.00
27_L	71_E	1.367	1.00
102_G	106_L	1.366	1.00
82_A	99_Y	1.353	1.00
63_L	67_F	1.321	1.00
24_V	100_M	1.320	1.00
67_F	70_K	1.293	1.00
68_E	94_K	1.275	1.00
27_L	33_I	1.263	1.00
75_V	104_M	1.262	1.00
24_V	73_A	1.259	1.00
21_P	100_M	1.242	1.00
38_I	85_A	1.241	1.00
21_P	25_R	1.237	1.00
18_D	101_I	1.233	1.00
34_M	53_I	1.220	1.00
19_L	24_V	1.209	1.00
36_L	66_L	1.199	1.00
104_M	108_M	1.185	1.00
33_I	73_A	1.176	1.00
86_T	99_Y	1.162	1.00
20_P	101_I	1.136	1.00
35_I	75_V	1.118	1.00
55_A	64_T	1.095	1.00
74_V	86_T	1.092	1.00
62_H	67_F	1.092	1.00
48_H	75_V	1.081	1.00
76_C	79_G	1.063	1.00
49_I	75_V	1.056	1.00
86_T	90_P	1.009	1.00
43_E	77_E	1.007	1.00
40_T	43_E	1.004	1.00
74_V	97_A	0.992	1.00
49_I	52_A	0.970	1.00
89_M	97_A	0.968	1.00
39_R	77_E	0.959	1.00
76_C	82_A	0.954	1.00
73_A	100_M	0.953	1.00
74_V	85_A	0.950	1.00
25_R	28_W	0.946	1.00
72_V	89_M	0.943	1.00
100_M	106_L	0.942	1.00
105_A	109_C	0.936	1.00
39_R	104_M	0.932	1.00
105_A	108_M	0.918	1.00
100_M	103_G	0.917	1.00
90_P	95_K	0.913	1.00
38_I	74_V	0.909	1.00
35_I	49_I	0.893	1.00
52_A	75_V	0.893	1.00
61_E	65_E	0.884	1.00
19_L	73_A	0.879	1.00
77_E	105_A	0.859	1.00
25_R	29_K	0.856	1.00
78_H	105_A	0.833	1.00
24_V	28_W	0.831	1.00
88_G	92_L	0.829	1.00
50_P	107_W	0.821	1.00
87_Y	91_H	0.815	1.00
90_P	97_A	0.810	1.00
100_M	107_W	0.804	1.00
22_S	110_L	0.803	1.00
76_C	81_R	0.798	1.00
22_S	26_K	0.790	1.00
47_H	104_M	0.773	1.00
23_M	26_K	0.766	1.00
33_I	71_E	0.765	1.00
89_M	94_K	0.764	1.00
24_V	27_L	0.762	1.00
42_Q	45_E	0.752	1.00
34_M	72_V	0.752	1.00
17_I	98_Y	0.747	1.00
34_M	67_F	0.745	1.00
17_I	90_P	0.727	1.00
18_D	99_Y	0.722	1.00
44_Y	52_A	0.717	1.00
43_E	46_E	0.709	1.00
17_I	86_T	0.703	1.00
44_Y	54_L	0.703	1.00
63_L	66_L	0.691	1.00
83_R	99_Y	0.689	1.00
66_L	72_V	0.676	1.00
106_L	109_C	0.661	1.00
59_Y	63_L	0.658	1.00
56_P	59_Y	0.653	1.00
48_H	54_L	0.648	1.00
24_V	33_I	0.646	1.00
26_K	30_S	0.644	1.00
27_L	31_G	0.638	1.00
30_S	33_I	0.635	1.00
19_L	33_I	0.631	1.00
72_V	94_K	0.619	1.00
55_A	60_L	0.617	1.00
27_L	73_A	0.615	1.00
78_H	81_R	0.607	1.00
60_L	85_A	0.602	1.00
62_H	66_L	0.599	1.00
64_T	67_F	0.592	1.00
41_P	59_Y	0.587	1.00
29_K	51_G	0.586	1.00
90_P	96_R	0.583	1.00
77_E	81_R	0.580	1.00
36_L	53_I	0.580	1.00
40_T	58_D	0.568	1.00
57_L	88_G	0.561	1.00
43_E	78_H	0.556	1.00
78_H	82_A	0.553	1.00
21_P	28_W	0.546	1.00
39_R	54_L	0.543	1.00
87_Y	90_P	0.541	1.00
29_K	32_K	0.541	1.00
72_V	97_A	0.538	1.00
28_W	51_G	0.531	1.00
88_G	91_H	0.530	1.00
19_L	27_L	0.526	1.00
39_R	43_E	0.522	1.00
57_L	84_Y	0.521	1.00
28_W	31_G	0.512	1.00
41_P	56_P	0.507	1.00
38_I	57_L	0.505	1.00
55_A	85_A	0.504	1.00
49_I	107_W	0.504	1.00
93_Y	96_R	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4jgtA	1	1	99.9	0.244	Contact Map
1rhsA	1	1	99.9	0.251	Contact Map
1urhA	1	0.9381	99.9	0.256	Contact Map
1yt8A	1	1	99.9	0.262	Contact Map
2hhgA	2	1	99.9	0.265	Contact Map
3utnX	1	1	99.9	0.266	Contact Map
3d1pA	1	0.885	99.9	0.266	Contact Map
3ilmA	2	0.8407	99.9	0.268	Contact Map
1e0cA	1	1	99.9	0.268	Contact Map
1qxnA	2	1	99.9	0.269	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.