Q7LX47 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LX47 - Uncharacterized protein

UniProt:	Q7LX47	Sequences: MEIDMESLDTVKNMKSELDLDIELINADATQFYSKFDTVIQNPPFGVVNRGIDIKFLQTAFSISDVVYSIHKSNERSREIIITMAKDYGFSTEILSERFRLKPYYPWHMRRVHEFLVDIYFFSKISR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	127 (120)
Sequences:	373 (283)
Seq/√Len:	25.9

HALSA - Q9HR55
SULSO - Q7LX47

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
11_V	24_L	4.524	1.00
2_E	8_L	3.833	1.00
78_R	118_D	3.401	1.00
59_T	62_S	3.232	1.00
103_P	111_R	3.006	1.00
101_L	104_Y	2.899	1.00
85_A	122_F	2.708	0.99
47_V	72_K	2.566	0.99
2_E	24_L	2.552	0.99
74_N	77_S	2.330	0.98
14_M	115_F	2.101	0.97
15_K	24_L	2.034	0.96
73_S	78_R	1.878	0.93
2_E	50_R	1.820	0.92
48_V	52_I	1.782	0.92
38_T	68_Y	1.770	0.91
8_L	27_A	1.711	0.90
57_L	71_H	1.661	0.88
2_E	31_Q	1.632	0.87
48_V	107_W	1.583	0.86
66_V	121_F	1.517	0.83
48_V	72_K	1.485	0.82
13_N	22_I	1.449	0.80
92_T	120_Y	1.421	0.79
101_L	109_M	1.413	0.78
8_L	26_N	1.410	0.78
54_I	80_I	1.382	0.77
70_I	77_S	1.380	0.77
8_L	24_L	1.375	0.77
14_M	72_K	1.351	0.75
57_L	60_A	1.344	0.75
2_E	11_V	1.310	0.73
81_I	120_Y	1.276	0.71
93_E	121_F	1.274	0.71
39_V	57_L	1.254	0.70
29_A	56_F	1.240	0.69
77_S	118_D	1.227	0.68
29_A	40_I	1.227	0.68
11_V	21_D	1.219	0.67
110_R	113_H	1.214	0.67
28_D	31_Q	1.194	0.66
61_F	90_F	1.181	0.65
5_M	103_P	1.165	0.64
73_S	118_D	1.164	0.64
3_I	13_N	1.146	0.62
29_A	63_I	1.145	0.62
74_N	118_D	1.141	0.62
69_S	122_F	1.128	0.61
39_V	64_S	1.125	0.61
10_T	25_I	1.098	0.59
48_V	54_I	1.076	0.57
41_Q	69_S	1.070	0.57
21_D	40_I	1.049	0.56
6_E	38_T	1.042	0.55
4_D	56_F	1.041	0.55
98_R	114_E	1.020	0.53
63_I	67_V	1.015	0.53
73_S	117_V	1.014	0.53
30_T	59_T	0.998	0.52
49_N	61_F	0.983	0.51
47_V	74_N	0.979	0.50
72_K	77_S	0.973	0.50
58_Q	84_M	0.970	0.50
52_I	58_Q	0.956	0.49
46_G	53_D	0.942	0.48
25_I	96_S	0.940	0.47
90_F	93_E	0.938	0.47
29_A	32_F	0.936	0.47
84_M	87_D	0.915	0.46
11_V	15_K	0.907	0.45
94_I	121_F	0.899	0.44
68_Y	121_F	0.891	0.44
101_L	115_F	0.885	0.43
5_M	26_N	0.883	0.43
78_R	117_V	0.881	0.43
42_N	45_F	0.878	0.43
12_K	22_I	0.877	0.43
80_I	88_Y	0.829	0.39
96_S	110_R	0.820	0.39
34_S	86_K	0.820	0.39
47_V	69_S	0.813	0.38
109_M	119_I	0.812	0.38
19_D	62_S	0.805	0.38
70_I	119_I	0.796	0.37
8_L	22_I	0.794	0.37
18_L	65_D	0.791	0.37
73_S	94_I	0.787	0.37
61_F	67_V	0.786	0.36
5_M	16_S	0.784	0.36
9_D	102_K	0.784	0.36
7_S	104_Y	0.782	0.36
11_V	57_L	0.778	0.36
44_P	53_D	0.772	0.36
42_N	53_D	0.772	0.36
45_F	53_D	0.772	0.36
60_A	83_T	0.770	0.35
80_I	116_L	0.769	0.35
16_S	19_D	0.768	0.35
8_L	11_V	0.751	0.34
72_K	95_L	0.751	0.34
96_S	116_L	0.750	0.34
88_Y	102_K	0.749	0.34
11_V	99_F	0.739	0.33
5_M	63_I	0.734	0.33
73_S	96_S	0.733	0.33
23_E	88_Y	0.727	0.33
107_W	121_F	0.723	0.32
100_R	114_E	0.718	0.32
86_K	101_L	0.711	0.32
82_I	105_Y	0.710	0.31
13_N	26_N	0.705	0.31
72_K	118_D	0.695	0.31
116_L	119_I	0.691	0.30
3_I	28_D	0.688	0.30
2_E	66_V	0.688	0.30
5_M	12_K	0.687	0.30
72_K	94_I	0.684	0.30
6_E	12_K	0.680	0.30
19_D	78_R	0.674	0.29
79_E	123_S	0.674	0.29
27_A	113_H	0.665	0.29
78_R	119_I	0.664	0.29
28_D	123_S	0.660	0.28
14_M	118_D	0.659	0.28
11_V	66_V	0.650	0.28
11_V	18_L	0.650	0.28
84_M	119_I	0.640	0.27
106_P	109_M	0.632	0.27
7_S	12_K	0.632	0.27
107_W	113_H	0.627	0.26
57_L	69_S	0.622	0.26
14_M	41_Q	0.622	0.26
100_R	118_D	0.620	0.26
26_N	51_G	0.617	0.26
7_S	37_D	0.613	0.26
94_I	119_I	0.613	0.26
66_V	88_Y	0.611	0.26
2_E	85_A	0.611	0.26
112_V	115_F	0.608	0.25
78_R	101_L	0.606	0.25
52_I	55_K	0.600	0.25
94_I	99_F	0.599	0.25
40_I	91_S	0.594	0.25
12_K	31_Q	0.590	0.24
105_Y	113_H	0.584	0.24
118_D	122_F	0.582	0.24
37_D	109_M	0.581	0.24
38_T	64_S	0.579	0.24
2_E	30_T	0.576	0.24
9_D	59_T	0.565	0.23
64_S	85_A	0.561	0.23
37_D	69_S	0.560	0.23
49_N	52_I	0.560	0.23
37_D	74_N	0.556	0.23
82_I	116_L	0.553	0.22
57_L	85_A	0.553	0.22
41_Q	104_Y	0.553	0.22
39_V	63_I	0.550	0.22
36_F	69_S	0.546	0.22
18_L	35_K	0.543	0.22
25_I	110_R	0.542	0.22
14_M	70_I	0.540	0.22
72_K	122_F	0.540	0.22
40_I	116_L	0.540	0.22
54_I	72_K	0.539	0.22
23_E	32_F	0.535	0.22
79_E	82_I	0.535	0.22
77_S	119_I	0.530	0.21
90_F	122_F	0.528	0.21
14_M	51_G	0.526	0.21
25_I	102_K	0.526	0.21
13_N	16_S	0.523	0.21
69_S	73_S	0.519	0.21
47_V	77_S	0.518	0.21
50_R	109_M	0.515	0.21
24_L	86_K	0.514	0.20
25_I	121_F	0.508	0.20
8_L	12_K	0.506	0.20
11_V	80_I	0.504	0.20
68_Y	94_I	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1wy7A	1	0.9843	99.7	0.643	Contact Map
1ne2A	2	0.9528	99.5	0.688	Contact Map
3tm4A	1	0.7717	98.9	0.769	Contact Map
3tmaA	2	0.811	98.7	0.784	Contact Map
2oyrA	1	0.7874	98.7	0.786	Contact Map
3vseA	1	0.9921	98.7	0.786	Contact Map
3lkdA	1	0.937	98.6	0.791	Contact Map
3lduA	1	0.8346	98.5	0.795	Contact Map
3khkA	1	0.937	98.5	0.796	Contact Map
2f8lA	1	0.9134	98.5	0.797	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.