Q7LX45 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q7LX45 - Uncharacterized protein

UniProt:	Q7LX45	Sequences: MSTDFLTTREKIFLLLFYSDEPLSAREIMRRLDVRKEKEVYDHLEHLARSSKRKGYMLIIIPAKCKSCGYVFNSDKIKKPSRCPICKSEKIEMPKFLIRNK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	101 (91)
Sequences:	139 (107)
Seq/√Len:	11.2

HALSA - Q9HS62
SULSO - Q7LX45

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
82_R	89_E	3.100	0.96
12_I	28_I	2.643	0.90
63_A	74_S	2.222	0.80
15_L	28_I	2.133	0.77
40_V	98_I	2.069	0.74
67_S	90_K	2.064	0.74
48_A	81_S	2.012	0.72
25_A	37_E	2.000	0.72
8_T	43_H	1.927	0.69
17_F	56_Y	1.925	0.69
45_E	76_K	1.921	0.69
12_I	47_L	1.845	0.65
51_S	98_I	1.709	0.59
13_F	47_L	1.700	0.59
26_R	37_E	1.693	0.58
59_I	89_E	1.645	0.56
32_L	44_L	1.543	0.51
46_H	50_S	1.497	0.49
51_S	97_L	1.480	0.48
82_R	87_K	1.451	0.47
66_K	92_E	1.448	0.47
24_S	92_E	1.440	0.46
25_A	41_Y	1.429	0.46
28_I	41_Y	1.416	0.45
51_S	56_Y	1.373	0.43
17_F	82_R	1.340	0.41
67_S	88_S	1.330	0.41
30_R	82_R	1.319	0.40
76_K	81_S	1.298	0.39
34_V	40_V	1.294	0.39
93_M	96_F	1.261	0.38
38_K	72_F	1.238	0.37
26_R	93_M	1.229	0.36
60_I	74_S	1.223	0.36
11_K	48_A	1.202	0.35
74_S	81_S	1.198	0.35
72_F	76_K	1.161	0.33
64_K	70_Y	1.147	0.33
29_M	37_E	1.130	0.32
27_E	40_V	1.128	0.32
25_A	38_K	1.118	0.31
55_G	63_A	1.067	0.29
7_T	40_V	1.057	0.29
22_P	46_H	1.052	0.29
32_L	38_K	1.049	0.29
43_H	78_K	1.047	0.29
15_L	24_S	1.041	0.28
55_G	58_L	1.038	0.28
25_A	85_I	1.020	0.28
56_Y	98_I	1.010	0.27
57_M	61_I	0.990	0.26
43_H	59_I	0.986	0.26
31_R	58_L	0.985	0.26
16_L	87_K	0.981	0.26
24_S	63_A	0.974	0.26
75_D	89_E	0.974	0.26
29_M	33_D	0.968	0.26
22_P	95_K	0.954	0.25
30_R	49_R	0.953	0.25
15_L	27_E	0.942	0.25
37_E	43_H	0.913	0.24
9_R	80_P	0.909	0.23
6_L	92_E	0.907	0.23
8_T	56_Y	0.898	0.23
24_S	95_K	0.880	0.22
42_D	94_P	0.875	0.22
45_E	77_I	0.856	0.22
46_H	80_P	0.851	0.21
8_T	32_L	0.844	0.21
92_E	95_K	0.841	0.21
28_I	60_I	0.841	0.21
39_E	43_H	0.839	0.21
80_P	94_P	0.838	0.21
85_I	95_K	0.812	0.20
28_I	35_R	0.790	0.20
14_L	51_S	0.784	0.19
6_L	14_L	0.775	0.19
34_V	92_E	0.773	0.19
33_D	99_R	0.764	0.19
7_T	63_A	0.760	0.19
39_E	72_F	0.758	0.19
11_K	67_S	0.752	0.18
51_S	58_L	0.750	0.18
25_A	42_D	0.749	0.18
16_L	47_L	0.741	0.18
21_E	49_R	0.735	0.18
74_S	77_I	0.731	0.18
47_L	50_S	0.717	0.17
24_S	32_L	0.710	0.17
33_D	52_K	0.707	0.17
60_I	63_A	0.702	0.17
6_L	34_V	0.702	0.17
60_I	93_M	0.698	0.17
31_R	79_K	0.697	0.17
27_E	53_R	0.696	0.17
49_R	99_R	0.692	0.17
27_E	98_I	0.678	0.16
20_D	70_Y	0.662	0.16
38_K	71_V	0.661	0.16
39_E	49_R	0.657	0.16
25_A	43_H	0.653	0.16
10_E	56_Y	0.653	0.16
44_L	85_I	0.648	0.16
40_V	85_I	0.636	0.15
9_R	91_I	0.636	0.15
37_E	77_I	0.634	0.15
34_V	96_F	0.628	0.15
70_Y	94_P	0.628	0.15
7_T	77_I	0.626	0.15
35_R	60_I	0.615	0.15
44_L	90_K	0.608	0.15
59_I	78_K	0.605	0.15
43_H	67_S	0.600	0.14
53_R	56_Y	0.595	0.14
26_R	76_K	0.595	0.14
26_R	29_M	0.595	0.14
24_S	27_E	0.585	0.14
20_D	47_L	0.577	0.14
33_D	90_K	0.571	0.14
29_M	32_L	0.558	0.13
72_F	79_K	0.554	0.13
58_L	87_K	0.550	0.13
10_E	29_M	0.545	0.13
79_K	91_I	0.539	0.13
25_A	50_S	0.537	0.13
66_K	81_S	0.536	0.13
9_R	46_H	0.534	0.13
27_E	91_I	0.530	0.13
9_R	12_I	0.527	0.13
70_Y	74_S	0.521	0.13
15_L	77_I	0.516	0.13
48_A	70_Y	0.515	0.12
29_M	74_S	0.513	0.12
22_P	50_S	0.504	0.12
32_L	41_Y	0.501	0.12
23_L	52_K	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2gmgA	1	0.9703	100	0.317	Contact Map
2o03A	2	0.8515	96.5	0.835	Contact Map
3mwmA	2	0.8515	96.1	0.843	Contact Map
2xigA	4	0.8911	95.8	0.847	Contact Map
4etsA	2	0.901	95.7	0.848	Contact Map
1qbjA	1	0.604	95.4	0.851	Contact Map
1qgpA	1	0.6733	95.4	0.851	Contact Map
3eyyA	2	0.802	95.1	0.853	Contact Map
4rayA	4	0.802	95.1	0.853	Contact Map
2fe3A	2	0.8812	95.1	0.853	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.