TRPG - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TRPG - Anthranilate synthase component 2

UniProt:	Q06129	Sequences: MDLTLIIDNYDSFVYNIAQIVGELGSYPIVIRNDEISIKGIERIDPDRIIISPGPGTPEKREDIGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKIRRARKVFHGKISNIILVNNSPLSLYYGIAKEFKATRYHSLVVDEVHRPLIVDAISAEDNEIMAIHHEEYPIYGVQFHPESVGTSLGYKILYNFLNRV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	195 (173)
Sequences:	11881 (6279)
Seq/√Len:	477.4

ECOLI - TRPGD PABA GUAA CARA
BACSU - GUAA PABA CARX CARA
HALSA - GUAAA TRPG CARA Q9HMK6
SULSO - TRPG GUAAA CARA Q97X97

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
91_G	140_V	3.092	1.00
99_R	141_D	2.802	1.00
90_I	169_I	2.700	1.00
97_K	141_D	2.371	1.00
24_L	189_Y	2.308	1.00
127_A	183_L	2.298	1.00
59_E	92_Y	2.236	1.00
3_L	27_Y	2.224	1.00
21_V	50_I	2.221	1.00
152_I	163_H	2.212	1.00
91_G	162_I	2.202	1.00
5_L	31_I	2.199	1.00
164_H	167_Y	2.156	1.00
150_D	163_H	2.137	1.00
23_E	185_Y	2.126	1.00
37_S	40_G	2.095	1.00
150_D	165_E	2.027	1.00
151_A	159_I	1.986	1.00
183_L	186_K	1.854	1.00
20_I	185_Y	1.835	1.00
6_I	18_A	1.804	1.00
68_L	93_A	1.799	1.00
153_S	161_A	1.768	1.00
131_K	182_S	1.726	1.00
9_N	51_I	1.712	1.00
164_H	168_P	1.710	1.00
71_I	89_A	1.671	1.00
69_D	72_K	1.659	1.00
42_E	73_Y	1.654	1.00
87_H	171_G	1.624	1.00
31_I	36_I	1.620	1.00
99_R	139_V	1.582	1.00
130_F	183_L	1.579	1.00
3_L	29_I	1.535	1.00
29_I	44_I	1.526	1.00
186_K	189_Y	1.494	1.00
163_H	170_Y	1.491	1.00
40_G	43_R	1.489	1.00
189_Y	193_N	1.482	1.00
68_L	72_K	1.459	1.00
148_I	166_E	1.452	1.00
109_I	133_T	1.439	1.00
102_R	158_E	1.424	1.00
106_H	137_S	1.402	1.00
140_V	162_I	1.401	1.00
42_E	77_R	1.373	1.00
68_L	92_Y	1.365	1.00
69_D	73_Y	1.348	1.00
17_I	83_V	1.343	1.00
162_I	171_G	1.315	1.00
133_T	180_G	1.313	1.00
51_I	67_S	1.302	1.00
6_I	50_I	1.295	1.00
90_I	171_G	1.292	1.00
4_T	48_R	1.292	1.00
126_I	130_F	1.288	1.00
94_F	169_I	1.275	1.00
10_Y	34_D	1.268	1.00
26_S	192_L	1.251	1.00
59_E	97_K	1.250	1.00
111_N	131_K	1.246	1.00
139_V	158_E	1.230	1.00
111_N	129_E	1.220	1.00
64_I	89_A	1.218	1.00
149_V	162_I	1.205	1.00
48_R	191_F	1.202	1.00
36_I	40_G	1.185	1.00
91_G	96_A	1.173	1.00
50_I	81_L	1.170	1.00
112_I	132_A	1.161	1.00
123_Y	161_A	1.158	1.00
148_I	165_E	1.155	1.00
49_I	70_V	1.143	1.00
87_H	140_V	1.134	1.00
38_I	42_E	1.098	1.00
109_I	131_K	1.090	1.00
59_E	63_D	1.083	1.00
24_L	188_L	1.067	1.00
98_I	140_V	1.061	1.00
130_F	187_I	1.060	1.00
17_I	188_L	1.058	1.00
29_I	46_P	1.048	1.00
16_N	19_Q	1.042	1.00
64_I	68_L	1.042	1.00
20_I	23_E	1.028	1.00
39_K	43_R	1.026	1.00
56_G	63_D	1.025	1.00
96_A	146_P	1.018	1.00
77_R	167_Y	1.016	1.00
165_E	168_P	1.007	1.00
110_S	129_E	1.006	1.00
36_I	44_I	0.971	1.00
72_K	93_A	0.971	1.00
39_K	42_E	0.971	1.00
101_A	139_V	0.960	1.00
149_V	164_H	0.956	1.00
4_T	26_S	0.948	1.00
148_I	164_H	0.944	1.00
97_K	142_E	0.942	1.00
5_L	44_I	0.941	1.00
121_S	163_H	0.939	1.00
9_N	67_S	0.935	1.00
132_A	181_T	0.932	1.00
5_L	41_I	0.922	1.00
84_C	175_H	0.919	1.00
51_I	80_I	0.915	1.00
18_A	22_G	0.912	1.00
49_I	78_T	0.911	1.00
76_K	167_Y	0.911	1.00
94_F	149_V	0.905	1.00
127_A	182_S	0.905	1.00
81_L	172_V	0.896	1.00
6_I	13_F	0.891	1.00
24_L	185_Y	0.891	1.00
87_H	162_I	0.890	1.00
100_R	104_V	0.887	1.00
70_V	73_Y	0.886	1.00
48_R	192_L	0.885	1.00
36_I	41_I	0.882	1.00
123_Y	190_N	0.882	1.00
38_I	73_Y	0.880	1.00
22_G	28_P	0.878	1.00
3_L	44_I	0.873	1.00
153_S	174_F	0.871	1.00
39_K	73_Y	0.871	1.00
126_I	183_L	0.870	1.00
7_I	31_I	0.865	1.00
121_S	170_Y	0.856	1.00
19_Q	22_G	0.855	1.00
83_V	172_V	0.848	1.00
91_G	146_P	0.841	1.00
64_I	67_S	0.837	1.00
152_I	170_Y	0.830	1.00
33_N	65_G	0.824	1.00
142_E	151_A	0.818	1.00
10_Y	32_R	0.818	1.00
67_S	89_A	0.815	1.00
57_T	63_D	0.811	1.00
145_R	151_A	0.806	1.00
172_V	176_P	0.806	1.00
5_L	46_P	0.805	1.00
9_N	33_N	0.804	1.00
7_I	70_V	0.804	1.00
24_L	192_L	0.801	1.00
103_K	156_D	0.801	1.00
57_T	138_L	0.801	1.00
174_F	187_I	0.795	1.00
125_G	190_N	0.794	1.00
152_I	161_A	0.790	1.00
163_H	190_N	0.789	1.00
127_A	130_F	0.777	1.00
42_E	78_T	0.776	1.00
145_R	159_I	0.774	1.00
130_F	184_G	0.771	1.00
41_I	46_P	0.762	1.00
126_I	186_K	0.761	1.00
21_V	188_L	0.759	1.00
84_C	88_Q	0.759	1.00
121_S	124_Y	0.756	1.00
154_A	158_E	0.754	1.00
71_I	90_I	0.753	1.00
94_F	164_H	0.751	1.00
4_T	21_V	0.751	1.00
21_V	192_L	0.751	1.00
154_A	157_N	0.743	1.00
123_Y	174_F	0.741	1.00
31_I	40_G	0.737	1.00
6_I	21_V	0.737	1.00
94_F	167_Y	0.737	1.00
71_I	80_I	0.732	1.00
170_Y	191_F	0.731	1.00
13_F	18_A	0.731	1.00
21_V	26_S	0.723	1.00
122_L	170_Y	0.720	1.00
110_S	155_E	0.719	1.00
14_V	30_V	0.717	1.00
134_R	160_M	0.717	1.00
15_Y	18_A	0.710	1.00
57_T	100_R	0.706	1.00
68_L	89_A	0.705	1.00
7_I	41_I	0.702	1.00
31_I	44_I	0.702	1.00
130_F	186_K	0.701	1.00
185_Y	189_Y	0.694	1.00
73_Y	77_R	0.694	1.00
59_E	98_I	0.693	1.00
3_L	47_D	0.692	1.00
26_S	48_R	0.689	1.00
65_G	93_A	0.679	1.00
104_V	137_S	0.669	1.00
18_A	30_V	0.668	1.00
19_Q	23_E	0.668	1.00
25_G	28_P	0.664	1.00
92_Y	97_K	0.661	1.00
66_V	71_I	0.660	1.00
123_Y	163_H	0.657	1.00
98_I	138_L	0.654	1.00
50_I	191_F	0.653	1.00
57_T	92_Y	0.652	1.00
164_H	169_I	0.652	1.00
16_N	20_I	0.646	1.00
46_P	78_T	0.638	1.00
66_V	89_A	0.637	1.00
6_I	52_S	0.634	1.00
8_D	14_V	0.633	1.00
66_V	69_D	0.627	1.00
7_I	36_I	0.624	0.99
56_G	59_E	0.624	0.99
66_V	70_V	0.617	0.99
40_G	44_I	0.616	0.99
6_I	14_V	0.614	0.99
133_T	178_S	0.613	0.99
38_I	69_D	0.613	0.99
108_K	133_T	0.607	0.99
110_S	131_K	0.601	0.99
121_S	190_N	0.598	0.99
14_V	52_S	0.597	0.99
174_F	184_G	0.597	0.99
81_L	187_I	0.594	0.99
96_A	140_V	0.594	0.99
133_T	182_S	0.592	0.99
49_I	80_I	0.592	0.99
125_G	186_K	0.591	0.99
20_I	188_L	0.590	0.99
68_L	71_I	0.590	0.99
123_Y	153_S	0.582	0.99
57_T	98_I	0.578	0.99
172_V	187_I	0.574	0.99
59_E	68_L	0.573	0.99
48_R	81_L	0.567	0.99
45_D	78_T	0.566	0.99
133_T	181_T	0.566	0.99
84_C	136_H	0.564	0.99
51_I	71_I	0.562	0.99
139_V	156_D	0.562	0.99
6_I	28_P	0.561	0.99
5_L	29_I	0.561	0.99
106_H	135_Y	0.555	0.99
9_N	89_A	0.550	0.99
80_I	90_I	0.550	0.99
71_I	93_A	0.546	0.99
88_Q	173_Q	0.545	0.99
101_A	158_E	0.537	0.98
112_I	129_E	0.532	0.98
33_N	66_V	0.530	0.98
142_E	145_R	0.528	0.98
53_P	84_C	0.528	0.98
65_G	68_L	0.527	0.98
126_I	187_I	0.526	0.98
112_I	153_S	0.525	0.98
5_L	36_I	0.517	0.98
65_G	92_Y	0.515	0.98
76_K	80_I	0.512	0.98
90_I	162_I	0.512	0.98
101_A	104_V	0.506	0.98
67_S	71_I	0.505	0.98
81_L	170_Y	0.504	0.98
48_R	79_P	0.504	0.98
121_S	152_I	0.501	0.98
105_F	110_S	0.500	0.98

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3tqiA	3	0.8821	100	0.23	Contact Map
2vxoA	2	0.9385	100	0.237	Contact Map
1gpmA	3	0.9538	100	0.243	Contact Map
2ywbA	4	0.9179	100	0.249	Contact Map
3uowA	2	0.9692	100	0.281	Contact Map
1a9xB	1	0.9231	100	0.315	Contact Map
1qdlB	2	0.9692	100	0.318	Contact Map
2vpiA	1	0.9077	100	0.325	Contact Map
1i1qB	1	0.9231	100	0.337	Contact Map
3r75A	2	0.9436	100	0.352	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.