RL12 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL12 - 50S ribosomal protein L12

UniProt:	P96040	Sequences: MEYIYASLLLHSAKKEISEDALKNVLTAAGISVDEVRLKAVVAALKEVNIDEVLKNAAAMPVAVAAQPQATQAQPAAEEKKEEKKEEEKKGPSEEEIASGLASLFG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	106 (106)
Sequences:	188 (140)
Seq/√Len:	13.6

HALSA - RL12
SULSO - RL12

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
18_S	21_A	5.325	1.00
33_V	38_L	2.843	0.96
57_A	61_P	2.586	0.93
16_E	35_E	2.413	0.90
49_N	89_K	2.321	0.88
13_A	31_I	2.235	0.86
26_L	37_R	2.194	0.85
26_L	29_A	2.192	0.85
81_K	85_K	2.091	0.82
23_K	27_T	2.048	0.81
49_N	52_E	2.038	0.81
6_A	44_A	1.772	0.70
12_S	34_D	1.732	0.68
24_N	27_T	1.699	0.67
93_S	96_E	1.656	0.65
7_S	41_V	1.615	0.63
9_L	25_V	1.615	0.63
8_L	12_S	1.533	0.59
36_V	44_A	1.503	0.57
99_S	103_S	1.378	0.50
37_R	40_A	1.375	0.50
23_K	38_L	1.375	0.50
23_K	34_D	1.348	0.49
49_N	55_K	1.306	0.47
14_K	96_E	1.290	0.46
80_K	85_K	1.287	0.46
66_A	71_T	1.275	0.45
17_I	43_A	1.269	0.45
35_E	76_A	1.268	0.45
36_V	97_I	1.256	0.44
54_L	90_K	1.244	0.43
1_M	5_Y	1.230	0.43
6_A	28_A	1.229	0.43
22_L	53_V	1.219	0.42
42_V	57_A	1.218	0.42
47_E	56_N	1.215	0.42
37_R	102_A	1.196	0.41
79_E	83_E	1.187	0.40
51_D	98_A	1.183	0.40
91_G	102_A	1.160	0.39
9_L	57_A	1.131	0.37
6_A	18_S	1.105	0.36
70_A	73_A	1.103	0.36
41_V	99_S	1.094	0.36
14_K	92_P	1.089	0.35
41_V	103_S	1.085	0.35
48_V	97_I	1.079	0.35
11_H	51_D	1.078	0.35
36_V	99_S	1.075	0.35
46_K	103_S	1.043	0.33
100_G	106_G	1.034	0.33
94_E	103_S	1.023	0.32
4_I	42_V	1.018	0.32
54_L	99_S	1.013	0.32
4_I	49_N	1.005	0.31
77_A	81_K	1.005	0.31
2_E	5_Y	1.001	0.31
28_A	44_A	0.994	0.31
8_L	98_A	0.990	0.31
92_P	95_E	0.978	0.30
16_E	55_K	0.972	0.30
93_S	98_A	0.949	0.29
5_Y	50_I	0.948	0.29
31_I	37_R	0.946	0.29
72_Q	76_A	0.946	0.29
51_D	54_L	0.921	0.28
41_V	53_V	0.916	0.27
52_E	82_E	0.914	0.27
38_L	85_K	0.902	0.27
92_P	97_I	0.896	0.27
21_A	43_A	0.896	0.27
53_V	59_A	0.873	0.26
1_M	50_I	0.863	0.25
29_A	40_A	0.855	0.25
81_K	88_E	0.849	0.25
16_E	49_N	0.844	0.25
79_E	84_K	0.837	0.24
5_Y	9_L	0.836	0.24
32_S	56_N	0.836	0.24
53_V	58_A	0.833	0.24
28_A	65_A	0.832	0.24
49_N	102_A	0.832	0.24
74_Q	77_A	0.816	0.23
43_A	86_E	0.810	0.23
15_K	24_N	0.808	0.23
69_Q	87_E	0.805	0.23
76_A	84_K	0.805	0.23
22_L	96_E	0.795	0.23
14_K	47_E	0.792	0.23
55_K	80_K	0.787	0.22
26_L	43_A	0.782	0.22
4_I	99_S	0.777	0.22
75_P	85_K	0.769	0.22
65_A	70_A	0.761	0.21
55_K	84_K	0.755	0.21
37_R	44_A	0.740	0.21
27_T	62_V	0.739	0.21
18_S	74_Q	0.733	0.20
52_E	62_V	0.731	0.20
90_K	93_S	0.729	0.20
3_Y	37_R	0.721	0.20
34_D	98_A	0.716	0.20
42_V	61_P	0.715	0.20
54_L	58_A	0.714	0.20
7_S	97_I	0.712	0.20
28_A	43_A	0.711	0.20
26_L	92_P	0.708	0.20
3_Y	39_K	0.707	0.20
25_V	33_V	0.706	0.19
48_V	86_E	0.705	0.19
95_E	103_S	0.702	0.19
25_V	78_E	0.696	0.19
59_A	62_V	0.696	0.19
20_D	23_K	0.691	0.19
12_S	98_A	0.691	0.19
72_Q	82_E	0.690	0.19
69_Q	83_E	0.686	0.19
3_Y	104_L	0.683	0.19
7_S	36_V	0.681	0.19
101_L	105_F	0.680	0.19
4_I	41_V	0.671	0.18
24_N	88_E	0.662	0.18
47_E	55_K	0.653	0.18
17_I	26_L	0.650	0.18
27_T	44_A	0.650	0.18
93_S	97_I	0.647	0.18
13_A	58_A	0.642	0.17
44_A	55_K	0.638	0.17
40_A	44_A	0.630	0.17
68_P	86_E	0.628	0.17
54_L	102_A	0.616	0.17
4_I	69_Q	0.616	0.17
11_H	15_K	0.611	0.16
19_E	50_I	0.597	0.16
90_K	96_E	0.597	0.16
73_A	76_A	0.595	0.16
21_A	35_E	0.594	0.16
63_A	70_A	0.594	0.16
21_A	94_E	0.582	0.16
60_M	64_V	0.582	0.16
14_K	91_G	0.581	0.16
4_I	7_S	0.581	0.16
84_K	87_E	0.575	0.15
6_A	35_E	0.565	0.15
13_A	29_A	0.557	0.15
100_G	105_F	0.555	0.15
66_A	72_Q	0.548	0.15
8_L	24_N	0.544	0.15
27_T	99_S	0.544	0.15
16_E	38_L	0.543	0.15
12_S	40_A	0.540	0.15
24_N	34_D	0.537	0.14
56_N	102_A	0.527	0.14
9_L	103_S	0.520	0.14
34_D	47_E	0.509	0.14
86_E	89_K	0.507	0.14
5_Y	29_A	0.505	0.14
92_P	96_E	0.501	0.13
43_A	92_P	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j3bu	1	0.5189	99.8	0.51	Contact Map
3izsv	1	0.5377	99.8	0.515	Contact Map
3j3bs	1	0.5377	99.8	0.52	Contact Map
3j61s	1	0.5283	99.7	0.524	Contact Map
3izst	1	0.5283	99.7	0.543	Contact Map
3j61u	2	0.5472	99.7	0.561	Contact Map
3a1yA	3	0.5472	99.5	0.604	Contact Map
1vq8G	1	0.0094	99.4	0.628	Contact Map
3j21k	1	0	98.1	0.767	Contact Map
3wy9C	1	0.2453	97.5	0.799	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.