SPT5 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SPT5 - Transcription elongation factor Spt5

UniProt:	P96036	Sequences: MEKPNMRNYYAIKVVGGQEINVALMLEERIKTNNIKGIYAIIVPPNLKGYVVLEAEGLHIVKPLIAGIRNARGLAQGLLPRDEILKIVSRKTVGPTVKPGDVVEVISGPFRGTQAQVIRVEEAKGEVVLNILESAFPLQVTVPLDQIKVSKR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	152 (134)
Sequences:	468 (306)
Seq/√Len:	26.4

HALSA - Q9HS73
SULSO - SPT5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
36_K	64_L	4.524	1.00
26_L	51_V	3.729	1.00
113_T	134_S	2.802	1.00
58_L	62_K	2.754	1.00
50_Y	128_V	2.468	0.99
18_Q	21_N	2.414	0.99
22_V	70_N	2.390	0.99
104_E	133_E	2.349	0.98
113_T	136_F	2.290	0.98
53_L	71_A	2.245	0.98
9_Y	87_I	2.192	0.97
103_V	115_A	2.118	0.97
65_I	71_A	2.110	0.97
52_V	79_L	2.061	0.96
108_G	112_G	1.947	0.95
38_I	64_L	1.918	0.95
104_E	134_S	1.893	0.94
102_V	117_V	1.780	0.92
9_Y	84_I	1.774	0.92
7_R	64_L	1.740	0.91
105_V	108_G	1.719	0.90
53_L	124_K	1.660	0.89
104_E	114_Q	1.646	0.88
17_G	29_R	1.618	0.88
23_A	43_V	1.579	0.86
116_Q	130_N	1.487	0.83
26_L	29_R	1.474	0.82
133_E	136_F	1.446	0.81
113_T	133_E	1.426	0.80
40_A	122_E	1.418	0.79
104_E	110_F	1.412	0.79
49_G	54_E	1.408	0.79
86_K	96_T	1.395	0.78
27_E	31_K	1.384	0.78
11_A	50_Y	1.366	0.77
93_V	129_L	1.329	0.75
23_A	41_I	1.321	0.74
29_R	38_I	1.299	0.73
110_F	113_T	1.298	0.73
52_V	136_F	1.297	0.73
65_I	120_V	1.285	0.72
20_I	45_P	1.280	0.72
82_D	85_L	1.277	0.72
104_E	113_T	1.252	0.70
110_F	134_S	1.244	0.70
97_V	117_V	1.234	0.69
23_A	42_I	1.232	0.69
99_P	115_A	1.226	0.69
20_I	41_I	1.216	0.68
18_Q	70_N	1.214	0.68
37_G	60_I	1.212	0.68
78_L	118_I	1.212	0.68
114_Q	134_S	1.167	0.65
10_Y	58_L	1.166	0.65
94_G	129_L	1.161	0.64
19_E	49_G	1.113	0.61
97_V	121_E	1.093	0.60
121_E	128_V	1.086	0.59
9_Y	85_L	1.069	0.58
114_Q	133_E	1.063	0.57
102_V	114_Q	1.058	0.57
42_I	87_I	1.041	0.56
71_A	96_T	1.036	0.55
97_V	109_P	1.026	0.55
22_V	68_I	1.024	0.54
109_P	129_L	1.018	0.54
16_G	52_V	1.014	0.54
102_V	134_S	1.007	0.53
18_Q	42_I	1.006	0.53
28_E	89_S	0.997	0.52
12_I	65_I	0.995	0.52
11_A	87_I	0.990	0.52
115_A	131_I	0.986	0.52
113_T	130_N	0.975	0.51
21_N	123_A	0.970	0.50
51_V	55_A	0.966	0.50
55_A	67_G	0.966	0.50
121_E	124_K	0.956	0.49
49_G	126_E	0.919	0.47
15_V	72_R	0.919	0.47
59_H	97_V	0.909	0.46
34_N	63_P	0.906	0.46
105_V	112_G	0.902	0.45
6_M	83_E	0.899	0.45
30_I	36_K	0.888	0.44
56_E	112_G	0.885	0.44
111_R	129_L	0.874	0.43
22_V	50_Y	0.867	0.43
12_I	53_L	0.850	0.42
80_P	83_E	0.847	0.41
31_K	50_Y	0.847	0.41
68_I	100_G	0.843	0.41
25_M	131_I	0.831	0.40
43_V	47_L	0.831	0.40
27_E	30_I	0.828	0.40
15_V	18_Q	0.819	0.39
102_V	108_G	0.819	0.39
33_N	127_V	0.819	0.39
110_F	133_E	0.804	0.38
102_V	133_E	0.801	0.38
64_L	67_G	0.800	0.38
79_L	117_V	0.795	0.38
50_Y	101_D	0.795	0.38
26_L	70_N	0.788	0.37
106_I	133_E	0.787	0.37
18_Q	87_I	0.786	0.37
88_V	125_G	0.784	0.37
47_L	52_V	0.778	0.37
86_K	112_G	0.770	0.36
52_V	114_Q	0.762	0.35
24_L	111_R	0.762	0.35
61_V	80_P	0.751	0.35
91_K	115_A	0.747	0.34
58_L	68_I	0.744	0.34
106_I	113_T	0.741	0.34
42_I	134_S	0.740	0.34
35_I	60_I	0.740	0.34
110_F	114_Q	0.736	0.34
85_L	88_V	0.735	0.34
72_R	105_V	0.731	0.33
13_K	42_I	0.731	0.33
73_G	126_E	0.731	0.33
105_V	115_A	0.729	0.33
79_L	114_Q	0.719	0.33
35_I	61_V	0.715	0.32
51_V	123_A	0.715	0.32
55_A	60_I	0.714	0.32
89_S	97_V	0.701	0.31
67_G	132_L	0.700	0.31
42_I	123_A	0.698	0.31
125_G	135_A	0.693	0.31
10_Y	114_Q	0.691	0.31
35_I	64_L	0.689	0.31
42_I	85_L	0.689	0.31
27_E	116_Q	0.675	0.30
39_Y	81_R	0.668	0.29
8_N	105_V	0.668	0.29
58_L	63_P	0.666	0.29
49_G	127_V	0.663	0.29
41_I	102_V	0.661	0.29
100_G	112_G	0.657	0.29
97_V	101_D	0.646	0.28
21_N	127_V	0.645	0.28
21_N	33_N	0.642	0.28
23_A	72_R	0.641	0.28
106_I	134_S	0.640	0.28
37_G	56_E	0.637	0.27
103_V	117_V	0.630	0.27
28_E	37_G	0.626	0.27
71_A	132_L	0.618	0.26
130_N	136_F	0.608	0.26
52_V	104_E	0.608	0.26
96_T	121_E	0.606	0.26
50_Y	68_I	0.599	0.25
35_I	127_V	0.595	0.25
12_I	20_I	0.593	0.25
110_F	115_A	0.592	0.25
82_D	127_V	0.590	0.25
82_D	90_R	0.588	0.25
29_R	98_K	0.587	0.25
55_A	92_T	0.583	0.24
128_V	131_I	0.580	0.24
17_G	118_I	0.578	0.24
27_E	79_L	0.575	0.24
93_V	96_T	0.571	0.24
61_V	65_I	0.571	0.24
16_G	41_I	0.570	0.24
59_H	86_K	0.569	0.24
5_N	77_G	0.567	0.23
93_V	112_G	0.564	0.23
84_I	87_I	0.563	0.23
73_G	119_R	0.559	0.23
80_P	95_P	0.556	0.23
8_N	77_G	0.555	0.23
14_V	19_E	0.554	0.23
88_V	105_V	0.552	0.23
79_L	116_Q	0.551	0.23
118_I	127_V	0.550	0.23
9_Y	47_L	0.549	0.23
89_S	137_P	0.548	0.22
52_V	133_E	0.544	0.22
22_V	103_V	0.544	0.22
77_G	97_V	0.540	0.22
113_T	137_P	0.539	0.22
41_I	60_I	0.535	0.22
110_F	131_I	0.534	0.22
10_Y	40_A	0.534	0.22
11_A	75_A	0.529	0.22
38_I	116_Q	0.528	0.21
83_E	113_T	0.527	0.21
91_K	125_G	0.526	0.21
20_I	24_L	0.526	0.21
13_K	50_Y	0.519	0.21
6_M	114_Q	0.516	0.21
30_I	88_V	0.514	0.21
26_L	74_L	0.508	0.20
70_N	119_R	0.505	0.20
29_R	67_G	0.505	0.20
97_V	127_V	0.504	0.20
24_L	116_Q	0.502	0.20
54_E	110_F	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3h7hB	1	0.5855	100	0.428	Contact Map
2exuA	2	0.6118	99.9	0.455	Contact Map
3p8bB	2	0.9605	99.9	0.5	Contact Map
2lq8A	1	0.9539	99.7	0.606	Contact Map
2jvvA	1	0.375	99.7	0.61	Contact Map
1m1hA	1	0.5658	99.5	0.66	Contact Map
2ougA	1	0.7697	99.5	0.669	Contact Map
3lpeA	1	0.5526	99.5	0.675	Contact Map
2xhcA	1	0.9539	99.3	0.71	Contact Map
1nz9A	1	0.3816	97.8	0.817	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.