RS2 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS2 - 30S ribosomal protein S2

UniProt:	P95993	Sequences: MKVTNLSEKEERGGELTEAEKEELRKSEKGAIIELLVPVDTYLSAGVHIGTHSCTKYMESFVYRVRAEGLYVLDVRKIDERLRIAAKFLSRYDPQDIIVVASRPYAYRPVQKFAEVVGSRALVGRIIPGTFTNPYLSTYIEPKVLLVSDPRTDTQAIKEAAKVGIPIVAFADTDAKIDYIDLIIPANNKGRKSLALLYWALARQILRERRVIPPDGDLAVPVSEFEMRLVQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	231 (180)
Sequences:	2542 (1112)
Seq/√Len:	82.9

ECOLI - RS2
BACSU - RS2
HALSA - RS2
SULSO - RS2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
111_Q	115_E	3.627	1.00
170_F	186_A	3.476	1.00
95_Q	143_K	3.218	1.00
88_F	168_V	3.210	1.00
146_L	201_L	3.143	1.00
145_L	160_A	2.965	1.00
204_Q	208_E	2.845	1.00
113_F	116_V	2.803	1.00
81_R	84_I	2.785	1.00
47_V	186_A	2.583	1.00
113_F	199_W	2.538	1.00
170_F	197_L	2.513	1.00
89_L	168_V	2.453	1.00
47_V	193_S	2.430	1.00
161_A	179_Y	2.415	1.00
89_L	201_L	2.388	1.00
73_L	173_T	2.337	1.00
82_L	200_A	2.287	1.00
122_L	130_T	2.188	1.00
88_F	144_V	2.126	1.00
57_Y	178_D	2.116	1.00
186_A	197_L	2.080	1.00
144_V	168_V	2.060	1.00
42_Y	47_V	2.027	1.00
62_V	173_T	2.000	1.00
74_D	77_K	1.928	1.00
116_V	203_R	1.905	1.00
101_A	106_A	1.866	1.00
147_V	167_I	1.733	1.00
86_A	204_Q	1.721	1.00
96_D	143_K	1.704	1.00
61_F	81_R	1.682	1.00
158_K	162_K	1.676	1.00
106_A	194_L	1.675	1.00
116_V	206_L	1.629	1.00
171_A	183_I	1.580	1.00
161_A	181_D	1.522	0.99
117_V	205_I	1.511	0.99
86_A	201_L	1.502	0.99
199_W	203_R	1.490	0.99
55_T	176_K	1.487	0.99
88_F	182_L	1.474	0.99
89_L	144_V	1.466	0.99
98_I	131_F	1.448	0.99
154_T	158_K	1.435	0.99
84_I	87_K	1.395	0.99
169_A	180_I	1.381	0.99
109_P	113_F	1.380	0.99
151_R	175_A	1.354	0.99
113_F	202_A	1.343	0.99
92_Y	211_V	1.319	0.99
88_F	91_R	1.297	0.98
150_P	180_I	1.277	0.98
172_D	189_K	1.276	0.98
89_L	205_I	1.272	0.98
82_L	197_L	1.223	0.98
77_K	81_R	1.204	0.97
37_V	82_L	1.185	0.97
146_L	198_Y	1.179	0.97
86_A	200_A	1.170	0.97
150_P	169_A	1.168	0.97
143_K	166_P	1.166	0.97
171_A	180_I	1.162	0.97
53_S	65_V	1.142	0.96
195_A	199_W	1.141	0.96
112_K	195_A	1.133	0.96
81_R	185_P	1.116	0.96
148_S	170_F	1.115	0.96
51_T	189_K	1.105	0.96
145_L	156_A	1.091	0.95
57_Y	176_K	1.070	0.95
107_Y	124_G	1.064	0.95
97_I	205_I	1.052	0.94
74_D	105_Y	1.052	0.94
51_T	172_D	1.042	0.94
205_I	209_R	1.039	0.94
37_V	200_A	1.024	0.93
36_L	86_A	1.019	0.93
168_V	182_L	1.013	0.93
90_S	211_V	1.008	0.93
41_T	44_S	1.008	0.93
119_S	209_R	1.001	0.93
203_R	206_L	0.999	0.92
149_D	152_T	0.993	0.92
91_R	168_V	0.993	0.92
113_F	195_A	0.992	0.92
90_S	207_R	0.984	0.92
197_L	201_L	0.983	0.92
111_Q	123_V	0.980	0.92
103_R	106_A	0.979	0.92
106_A	148_S	0.960	0.91
46_G	49_I	0.960	0.91
57_Y	134_P	0.950	0.90
42_Y	82_L	0.948	0.90
134_P	138_T	0.948	0.90
112_K	115_E	0.946	0.90
157_I	167_I	0.941	0.90
127_I	130_T	0.935	0.90
125_R	128_P	0.927	0.89
114_A	119_S	0.927	0.89
171_A	175_A	0.925	0.89
160_A	167_I	0.921	0.89
100_V	131_F	0.914	0.89
116_V	202_A	0.903	0.88
41_T	200_A	0.903	0.88
97_I	144_V	0.900	0.88
158_K	161_A	0.870	0.86
96_D	120_R	0.865	0.86
133_N	159_E	0.860	0.85
98_I	145_L	0.859	0.85
109_P	192_K	0.856	0.85
186_A	193_S	0.854	0.85
180_I	183_I	0.843	0.84
212_I	215_D	0.841	0.84
161_A	167_I	0.829	0.83
117_V	206_L	0.822	0.83
103_R	153_D	0.820	0.83
63_Y	76_R	0.813	0.82
64_R	82_L	0.811	0.82
85_A	183_I	0.809	0.82
90_S	93_D	0.804	0.81
113_F	203_R	0.803	0.81
206_L	210_R	0.803	0.81
120_R	150_P	0.802	0.81
109_P	195_A	0.799	0.81
147_V	160_A	0.798	0.81
61_F	183_I	0.791	0.80
109_P	194_L	0.790	0.80
66_R	196_L	0.790	0.80
96_D	139_Y	0.780	0.79
87_K	90_S	0.779	0.79
148_S	153_D	0.777	0.79
79_D	83_R	0.776	0.79
193_S	197_L	0.773	0.79
38_P	41_T	0.770	0.78
108_R	112_K	0.770	0.78
117_V	202_A	0.770	0.78
157_I	180_I	0.767	0.78
39_V	79_D	0.759	0.77
51_T	188_N	0.756	0.77
184_I	197_L	0.750	0.77
94_P	212_I	0.749	0.77
91_R	169_A	0.746	0.76
149_D	153_D	0.740	0.76
151_R	174_D	0.739	0.76
103_R	149_D	0.738	0.75
154_T	179_Y	0.736	0.75
184_I	201_L	0.732	0.75
172_D	188_N	0.729	0.75
96_D	118_G	0.724	0.74
82_L	86_A	0.717	0.73
109_P	198_Y	0.717	0.73
86_A	197_L	0.716	0.73
72_V	75_V	0.715	0.73
95_Q	120_R	0.712	0.73
114_A	174_D	0.708	0.72
127_I	134_P	0.707	0.72
131_F	163_V	0.700	0.72
124_G	210_R	0.700	0.72
179_Y	183_I	0.698	0.71
119_S	205_I	0.697	0.71
211_V	214_P	0.696	0.71
141_E	165_I	0.695	0.71
118_G	206_L	0.693	0.71
95_Q	182_L	0.689	0.70
46_G	192_K	0.686	0.70
208_E	212_I	0.685	0.70
106_A	153_D	0.685	0.70
89_L	146_L	0.684	0.70
129_G	133_N	0.684	0.70
96_D	140_I	0.684	0.70
118_G	209_R	0.682	0.70
213_P	216_G	0.681	0.69
53_S	69_G	0.680	0.69
41_T	172_D	0.679	0.69
61_F	182_L	0.676	0.69
59_E	71_Y	0.670	0.68
141_E	144_V	0.663	0.67
39_V	47_V	0.659	0.67
147_V	157_I	0.651	0.66
138_T	141_E	0.650	0.66
107_Y	123_V	0.649	0.66
200_A	206_L	0.648	0.66
74_D	94_P	0.645	0.65
96_D	119_S	0.645	0.65
38_P	162_K	0.643	0.65
62_V	73_L	0.642	0.65
77_K	80_E	0.636	0.64
56_K	59_E	0.635	0.64
48_H	142_P	0.633	0.64
125_R	159_E	0.628	0.63
155_Q	158_K	0.621	0.62
54_C	62_V	0.619	0.62
102_S	122_L	0.619	0.62
198_Y	201_L	0.618	0.62
210_R	213_P	0.616	0.62
135_Y	138_T	0.615	0.62
87_K	91_R	0.614	0.62
65_V	205_I	0.614	0.62
129_G	132_T	0.614	0.62
70_L	190_G	0.610	0.61
81_R	87_K	0.609	0.61
91_R	144_V	0.607	0.61
56_K	134_P	0.606	0.61
127_I	139_Y	0.605	0.60
58_M	71_Y	0.605	0.60
212_I	216_G	0.602	0.60
146_L	184_I	0.602	0.60
196_L	200_A	0.598	0.59
154_T	157_I	0.597	0.59
76_R	81_R	0.595	0.59
58_M	62_V	0.593	0.59
140_I	157_I	0.591	0.59
82_L	193_S	0.589	0.58
110_V	148_S	0.589	0.58
99_V	110_V	0.589	0.58
49_I	66_R	0.589	0.58
103_R	148_S	0.587	0.58
113_F	117_V	0.587	0.58
150_P	200_A	0.586	0.58
123_V	193_S	0.586	0.58
129_G	159_E	0.584	0.58
100_V	145_L	0.584	0.58
205_I	208_E	0.583	0.58
152_T	169_A	0.576	0.57
89_L	97_I	0.572	0.56
37_V	79_D	0.571	0.56
127_I	163_V	0.569	0.56
102_S	159_E	0.568	0.56
83_R	211_V	0.567	0.55
97_I	119_S	0.565	0.55
210_R	214_P	0.562	0.55
90_S	108_R	0.562	0.55
198_Y	202_A	0.562	0.55
120_R	144_V	0.559	0.54
43_L	66_R	0.558	0.54
206_L	212_I	0.558	0.54
150_P	171_A	0.558	0.54
115_E	121_A	0.556	0.54
128_P	189_K	0.556	0.54
82_L	214_P	0.550	0.53
104_P	128_P	0.549	0.53
77_K	171_A	0.549	0.53
40_D	44_S	0.546	0.53
40_D	73_L	0.545	0.53
88_F	209_R	0.545	0.53
156_A	167_I	0.542	0.52
148_S	198_Y	0.540	0.52
84_I	182_L	0.540	0.52
175_A	181_D	0.539	0.52
127_I	147_V	0.533	0.51
150_P	179_Y	0.533	0.51
60_S	77_K	0.529	0.50
77_K	180_I	0.526	0.50
112_K	116_V	0.524	0.50
102_S	189_K	0.522	0.50
41_T	199_W	0.518	0.49
106_A	149_D	0.518	0.49
122_L	135_Y	0.517	0.49
82_L	170_F	0.517	0.49
97_I	209_R	0.516	0.49
206_L	209_R	0.514	0.49
119_S	144_V	0.513	0.48
81_R	183_I	0.511	0.48
48_H	190_G	0.509	0.48
157_I	171_A	0.508	0.48
81_R	171_A	0.505	0.47
97_I	166_P	0.505	0.47
38_P	196_L	0.502	0.47
93_D	139_Y	0.500	0.47

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j38A	1	0.8745	100	0.14	Contact Map
3j7aC	1	0.8398	100	0.143	Contact Map
4ujpB	1	0.8831	100	0.144	Contact Map
4w23A	1	0.8874	100	0.147	Contact Map
3j60A	1	0.8485	100	0.147	Contact Map
3zeyC	1	0.8745	100	0.15	Contact Map
3bchA	1	0.8485	100	0.153	Contact Map
4bpeB	1	0.8571	100	0.154	Contact Map
3j20B	1	0.8701	100	0.158	Contact Map
1vi6A	2	0.8398	100	0.174	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.